Index index by Group index by Distribution index by Vendor index by creation date index by Name Mirrors Help Search

qt6-doc-html-6.6.2-1.el9 RPM for noarch

From EPEL 9 for s390x / Packages / q

Name: qt6-doc-html Distribution: Fedora Project
Version: 6.6.2 Vendor: Fedora Project
Release: 1.el9 Build date: Tue Apr 30 23:00:04 2024
Group: Unspecified Build host: buildvm-a64-28.iad2.fedoraproject.org
Size: 298500026 Source RPM: qt6-doc-6.6.2-1.el9.src.rpm
Packager: Fedora Project
Url: http://qt-project.org/
Summary: Qt API Documentation in HTML format
Qt API Documentation in HTML format.

Provides

Requires

License

GFDL

Changelog

* Sat Feb 17 2024 Marie Loise Nolden <loise@kde.org> - 6.6.2-1
  - update to 6.6.2
* Fri Jan 26 2024 Fedora Release Engineering <releng@fedoraproject.org> - 6.6.1-3
  - Rebuilt for https://fedoraproject.org/wiki/Fedora_40_Mass_Rebuild
* Mon Jan 22 2024 Fedora Release Engineering <releng@fedoraproject.org> - 6.6.1-2
  - Rebuilt for https://fedoraproject.org/wiki/Fedora_40_Mass_Rebuild
* Tue Jan 02 2024 Marie Loise Nolden <loise@kde.org> - 6.6.1-1
  - Initial import based on qt5-doc. Simplify and split into qt6-doc,
    qt6-doc-devel (QCH) and qt6-doc-html (only HTML files)

Files

/usr/share/doc/qt6/activeqt/activeqt-activeqt-comapp-example.html
/usr/share/doc/qt6/activeqt/activeqt-activeqt-qutlook-example.html
/usr/share/doc/qt6/activeqt/activeqt-activeqt-simple-example.html
/usr/share/doc/qt6/activeqt/activeqt-activeqt-wrapper-example.html
/usr/share/doc/qt6/activeqt/activeqt-container.html
/usr/share/doc/qt6/activeqt/activeqt-dumpcpp.html
/usr/share/doc/qt6/activeqt/activeqt-dumpdoc.html
/usr/share/doc/qt6/activeqt/activeqt-examples.html
/usr/share/doc/qt6/activeqt/activeqt-index.html
/usr/share/doc/qt6/activeqt/activeqt-server.html
/usr/share/doc/qt6/activeqt/activeqt-tools.html
/usr/share/doc/qt6/activeqt/activeqt.index
/usr/share/doc/qt6/activeqt/activeqt.qhp
/usr/share/doc/qt6/activeqt/activeqt.qhp.sha1
/usr/share/doc/qt6/activeqt/examples-manifest.xml
/usr/share/doc/qt6/activeqt/images
/usr/share/doc/qt6/activeqt/images/arrow_bc.png
/usr/share/doc/qt6/activeqt/images/bgrContent.png
/usr/share/doc/qt6/activeqt/images/btn_next.png
/usr/share/doc/qt6/activeqt/images/btn_prev.png
/usr/share/doc/qt6/activeqt/images/bullet_dn.png
/usr/share/doc/qt6/activeqt/images/bullet_sq.png
/usr/share/doc/qt6/activeqt/images/home.png
/usr/share/doc/qt6/activeqt/images/ico_note.png
/usr/share/doc/qt6/activeqt/images/ico_note_attention.png
/usr/share/doc/qt6/activeqt/images/ico_out.png
/usr/share/doc/qt6/activeqt/images/logo.png
/usr/share/doc/qt6/activeqt/qaxaggregated-members.html
/usr/share/doc/qt6/activeqt/qaxaggregated.html
/usr/share/doc/qt6/activeqt/qaxbase-members.html
/usr/share/doc/qt6/activeqt/qaxbase.html
/usr/share/doc/qt6/activeqt/qaxbaseobject-members.html
/usr/share/doc/qt6/activeqt/qaxbaseobject.html
/usr/share/doc/qt6/activeqt/qaxbasewidget-members.html
/usr/share/doc/qt6/activeqt/qaxbasewidget.html
/usr/share/doc/qt6/activeqt/qaxbindable-members.html
/usr/share/doc/qt6/activeqt/qaxbindable.html
/usr/share/doc/qt6/activeqt/qaxcontainer-module.html
/usr/share/doc/qt6/activeqt/qaxfactory-members.html
/usr/share/doc/qt6/activeqt/qaxfactory-obsolete.html
/usr/share/doc/qt6/activeqt/qaxfactory.html
/usr/share/doc/qt6/activeqt/qaxobject-members.html
/usr/share/doc/qt6/activeqt/qaxobject.html
/usr/share/doc/qt6/activeqt/qaxobjectinterface-members.html
/usr/share/doc/qt6/activeqt/qaxobjectinterface.html
/usr/share/doc/qt6/activeqt/qaxscript-members.html
/usr/share/doc/qt6/activeqt/qaxscript.html
/usr/share/doc/qt6/activeqt/qaxscriptengine-members.html
/usr/share/doc/qt6/activeqt/qaxscriptengine.html
/usr/share/doc/qt6/activeqt/qaxscriptmanager-members.html
/usr/share/doc/qt6/activeqt/qaxscriptmanager.html
/usr/share/doc/qt6/activeqt/qaxselect-members.html
/usr/share/doc/qt6/activeqt/qaxselect.html
/usr/share/doc/qt6/activeqt/qaxserver-demo-simple.html
/usr/share/doc/qt6/activeqt/qaxserver-demo-wrapper.html
/usr/share/doc/qt6/activeqt/qaxserver-module.html
/usr/share/doc/qt6/activeqt/qaxwidget-members.html
/usr/share/doc/qt6/activeqt/qaxwidget.html
/usr/share/doc/qt6/activeqt/style
/usr/share/doc/qt6/activeqt/style/offline-dark.css
/usr/share/doc/qt6/activeqt/style/offline-simple.css
/usr/share/doc/qt6/activeqt/style/offline.css
/usr/share/doc/qt6/qdoc/01-qdoc-manual.html
/usr/share/doc/qt6/qdoc/03-qdoc-commands-markup.html
/usr/share/doc/qt6/qdoc/04-qdoc-commands-textmarkup.html
/usr/share/doc/qt6/qdoc/05-qdoc-commands-documentstructure.html
/usr/share/doc/qt6/qdoc/06-qdoc-commands-includecodeinline.html
/usr/share/doc/qt6/qdoc/07-0-qdoc-commands-includingexternalcode.html
/usr/share/doc/qt6/qdoc/08-qdoc-commands-creatinglinks.html
/usr/share/doc/qt6/qdoc/09-qdoc-commands-includingimages.html
/usr/share/doc/qt6/qdoc/10-qdoc-commands-tablesandlists.html
/usr/share/doc/qt6/qdoc/11-qdoc-commands-specialcontent.html
/usr/share/doc/qt6/qdoc/12-0-qdoc-commands-miscellaneous.html
/usr/share/doc/qt6/qdoc/13-qdoc-commands-topics.html
/usr/share/doc/qt6/qdoc/14-qdoc-commands-contextcommands.html
/usr/share/doc/qt6/qdoc/15-qdoc-commands-navigation.html
/usr/share/doc/qt6/qdoc/16-qdoc-commands-status.html
/usr/share/doc/qt6/qdoc/17-qdoc-commands-thread.html
/usr/share/doc/qt6/qdoc/18-qdoc-commands-relating.html
/usr/share/doc/qt6/qdoc/19-qdoc-commands-grouping.html
/usr/share/doc/qt6/qdoc/20-qdoc-commands-namingthings.html
/usr/share/doc/qt6/qdoc/21-0-qdoc-configuration.html
/usr/share/doc/qt6/qdoc/21-1-minimum-qdocconf.html
/usr/share/doc/qt6/qdoc/21-2-qtgui-qdocconf.html
/usr/share/doc/qt6/qdoc/22-creating-help-project-files.html
/usr/share/doc/qt6/qdoc/22-qdoc-configuration-generalvariables.html
/usr/share/doc/qt6/qdoc/24-qdoc-configuration-htmlvariables.html
/usr/share/doc/qt6/qdoc/25-qdoc-configuration-derivedprojects.html
/usr/share/doc/qt6/qdoc/26-qdoc-configuration-example-manifest-files.html
/usr/share/doc/qt6/qdoc/27-qdoc-commands-alphabetical.html
/usr/share/doc/qt6/qdoc/corefeatures.html
/usr/share/doc/qt6/qdoc/images
/usr/share/doc/qt6/qdoc/images/arrow_bc.png
/usr/share/doc/qt6/qdoc/images/bgrContent.png
/usr/share/doc/qt6/qdoc/images/btn_next.png
/usr/share/doc/qt6/qdoc/images/btn_prev.png
/usr/share/doc/qt6/qdoc/images/bullet_dn.png
/usr/share/doc/qt6/qdoc/images/bullet_sq.png
/usr/share/doc/qt6/qdoc/images/home.png
/usr/share/doc/qt6/qdoc/images/ico_note.png
/usr/share/doc/qt6/qdoc/images/ico_note_attention.png
/usr/share/doc/qt6/qdoc/images/ico_out.png
/usr/share/doc/qt6/qdoc/images/logo.png
/usr/share/doc/qt6/qdoc/qdoc-categories.html
/usr/share/doc/qt6/qdoc/qdoc-guide-clang.html
/usr/share/doc/qt6/qdoc/qdoc-guide-conf.html
/usr/share/doc/qt6/qdoc/qdoc-guide-writing.html
/usr/share/doc/qt6/qdoc/qdoc-guide.html
/usr/share/doc/qt6/qdoc/qdoc-index.html
/usr/share/doc/qt6/qdoc/qdoc-macros-cmake-text-snippets.html
/usr/share/doc/qt6/qdoc/qdoc-macros-formatting.html
/usr/share/doc/qt6/qdoc/qdoc-macros-misc.html
/usr/share/doc/qt6/qdoc/qdoc-macros-product-names.html
/usr/share/doc/qt6/qdoc/qdoc-macros-product-versions.html
/usr/share/doc/qt6/qdoc/qdoc-macros-tabbed-content.html
/usr/share/doc/qt6/qdoc/qdoc-macros-youtube-videos.html
/usr/share/doc/qt6/qdoc/qdoc-macros.html
/usr/share/doc/qt6/qdoc/qdoc-warnings.html
/usr/share/doc/qt6/qdoc/qdoc.index
/usr/share/doc/qt6/qdoc/qdoc.qhp
/usr/share/doc/qt6/qdoc/qdoc.qhp.sha1
/usr/share/doc/qt6/qdoc/qtgui-qdocconf.html
/usr/share/doc/qt6/qdoc/qtwritingstyle-cpp.html
/usr/share/doc/qt6/qdoc/qtwritingstyle-qml.html
/usr/share/doc/qt6/qdoc/style
/usr/share/doc/qt6/qdoc/style/offline-dark.css
/usr/share/doc/qt6/qdoc/style/offline-simple.css
/usr/share/doc/qt6/qdoc/style/offline.css
/usr/share/doc/qt6/qmake/images
/usr/share/doc/qt6/qmake/images/arrow_bc.png
/usr/share/doc/qt6/qmake/images/bgrContent.png
/usr/share/doc/qt6/qmake/images/btn_next.png
/usr/share/doc/qt6/qmake/images/btn_prev.png
/usr/share/doc/qt6/qmake/images/bullet_dn.png
/usr/share/doc/qt6/qmake/images/bullet_sq.png
/usr/share/doc/qt6/qmake/images/home.png
/usr/share/doc/qt6/qmake/images/ico_note.png
/usr/share/doc/qt6/qmake/images/ico_note_attention.png
/usr/share/doc/qt6/qmake/images/ico_out.png
/usr/share/doc/qt6/qmake/images/logo.png
/usr/share/doc/qt6/qmake/images/qmake-precompile-ui.png
/usr/share/doc/qt6/qmake/qmake-advanced-usage.html
/usr/share/doc/qt6/qmake/qmake-common-projects.html
/usr/share/doc/qt6/qmake/qmake-environment-reference.html
/usr/share/doc/qt6/qmake/qmake-function-reference.html
/usr/share/doc/qt6/qmake/qmake-language.html
/usr/share/doc/qt6/qmake/qmake-manual.html
/usr/share/doc/qt6/qmake/qmake-overview.html
/usr/share/doc/qt6/qmake/qmake-platform-notes.html
/usr/share/doc/qt6/qmake/qmake-precompiledheaders.html
/usr/share/doc/qt6/qmake/qmake-project-files.html
/usr/share/doc/qt6/qmake/qmake-reference.html
/usr/share/doc/qt6/qmake/qmake-running.html
/usr/share/doc/qt6/qmake/qmake-test-function-reference.html
/usr/share/doc/qt6/qmake/qmake-tutorial.html
/usr/share/doc/qt6/qmake/qmake-variable-reference.html
/usr/share/doc/qt6/qmake/qmake.index
/usr/share/doc/qt6/qmake/qmake.qhp
/usr/share/doc/qt6/qmake/qmake.qhp.sha1
/usr/share/doc/qt6/qmake/style
/usr/share/doc/qt6/qmake/style/offline-dark.css
/usr/share/doc/qt6/qmake/style/offline-simple.css
/usr/share/doc/qt6/qmake/style/offline.css
/usr/share/doc/qt6/qt3d/examples-manifest.xml
/usr/share/doc/qt6/qt3d/images
/usr/share/doc/qt6/qt3d/images/Space-invaders.jpg
/usr/share/doc/qt6/qt3d/images/arrow_bc.png
/usr/share/doc/qt6/qt3d/images/basicshapes-cpp-example.jpg
/usr/share/doc/qt6/qt3d/images/bgrContent.png
/usr/share/doc/qt6/qt3d/images/btn_next.png
/usr/share/doc/qt6/qt3d/images/btn_prev.png
/usr/share/doc/qt6/qt3d/images/bullet_dn.png
/usr/share/doc/qt6/qt3d/images/bullet_sq.png
/usr/share/doc/qt6/qt3d/images/deferred-framegraph.png
/usr/share/doc/qt6/qt3d/images/ecs-1.png
/usr/share/doc/qt6/qt3d/images/ecs-2.png
/usr/share/doc/qt6/qt3d/images/framegraph-parallel-build.png
/usr/share/doc/qt6/qt3d/images/home.png
/usr/share/doc/qt6/qt3d/images/ico_note.png
/usr/share/doc/qt6/qt3d/images/ico_note_attention.png
/usr/share/doc/qt6/qt3d/images/ico_out.png
/usr/share/doc/qt6/qt3d/images/logo.png
/usr/share/doc/qt6/qt3d/images/multiviewport-1.png
/usr/share/doc/qt6/qt3d/images/multiviewport-2.png
/usr/share/doc/qt6/qt3d/images/multiviewport-qml-example.jpg
/usr/share/doc/qt6/qt3d/images/multiviewport.png
/usr/share/doc/qt6/qt3d/images/pbr-materials.png
/usr/share/doc/qt6/qt3d/images/qt3d-wireframe-rendering.png
/usr/share/doc/qt6/qt3d/images/shadowmapping-depth.png
/usr/share/doc/qt6/qt3d/images/shadowmapping-qt3d.png
/usr/share/doc/qt6/qt3d/images/simple-cpp.png
/usr/share/doc/qt6/qt3d/images/simple-custom-material.jpg
/usr/share/doc/qt6/qt3d/images/simple-framegraph.png
/usr/share/doc/qt6/qt3d/images/simple-qml.png
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-abstractanimation-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-abstractanimation.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-abstractclipanimator-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-abstractclipanimator.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-abstractclipblendnode-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-abstractclipblendnode.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-additiveclipblend-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-additiveclipblend.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-animationcontroller-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-animationcontroller.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-animationgroup-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-animationgroup.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-blendedclipanimator-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-blendedclipanimator.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-clipanimator-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-clipanimator.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-clipblendvalue-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-clipblendvalue.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-keyframeanimation-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-keyframeanimation.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-lerpclipblend-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-lerpclipblend.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-morphinganimation-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-morphinganimation.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-morphtarget-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-morphtarget.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-vertexblendanimation-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-animation-vertexblendanimation.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-abstractskeleton-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-abstractskeleton.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-armature-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-armature.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-attribute-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-attribute.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-boundingvolume-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-boundingvolume.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-buffer-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-buffer.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-component3d-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-component3d.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-coresettings-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-coresettings.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-entity-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-entity.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-entityloader-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-entityloader.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-geometry-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-geometry.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-geometryview-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-geometryview.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-joint-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-joint.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-node-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-node.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-nodeinstantiator-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-nodeinstantiator.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-quaternionanimation-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-quaternionanimation.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-skeleton-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-skeleton.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-skeletonloader-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-skeletonloader.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-transform-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-core-transform.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-conegeometry-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-conegeometry.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-conegeometryview-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-conegeometryview.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-conemesh-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-conemesh.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-cuboidgeometry-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-cuboidgeometry.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-cuboidgeometryview-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-cuboidgeometryview.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-cuboidmesh-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-cuboidmesh.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-cylindergeometry-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-cylindergeometry.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-cylindergeometryview-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-cylindergeometryview.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-cylindermesh-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-cylindermesh.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-diffusemapmaterial-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-diffusemapmaterial.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-diffusespecularmapmaterial-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-diffusespecularmapmaterial.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-diffusespecularmaterial-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-diffusespecularmaterial.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-extrudedtextgeometry-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-extrudedtextgeometry.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-extrudedtextmesh-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-extrudedtextmesh.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-firstpersoncameracontroller-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-firstpersoncameracontroller.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-forwardrenderer-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-forwardrenderer-obsolete.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-forwardrenderer.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-goochmaterial-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-goochmaterial.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-metalroughmaterial-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-metalroughmaterial.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-normaldiffusemapalphamaterial-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-normaldiffusemapalphamaterial.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-normaldiffusemapmaterial-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-normaldiffusemapmaterial.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-normaldiffusespecularmapmaterial-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-normaldiffusespecularmapmaterial.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-orbitcameracontroller-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-orbitcameracontroller.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-pervertexcolormaterial-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-pervertexcolormaterial.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-phongalphamaterial-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-phongalphamaterial.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-phongmaterial-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-phongmaterial.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-planegeometry-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-planegeometry.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-planegeometryview-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-planegeometryview.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-planemesh-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-planemesh.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-skyboxentity-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-skyboxentity.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-spheregeometry-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-spheregeometry.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-spheregeometryview-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-spheregeometryview.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-spheremesh-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-spheremesh.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-text2dentity-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-text2dentity.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-torusgeometry-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-torusgeometry.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-torusgeometryview-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-torusgeometryview.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-torusmesh-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-extras-torusmesh.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-abstractactioninput-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-abstractactioninput.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-abstractaxisinput-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-abstractaxisinput.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-abstractphysicaldevice-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-abstractphysicaldevice.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-action-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-action.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-actioninput-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-actioninput.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-analogaxisinput-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-analogaxisinput.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-axis-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-axis.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-axisaccumulator-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-axisaccumulator.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-axissetting-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-axissetting.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-buttonaxisinput-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-buttonaxisinput.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-inputchord-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-inputchord.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-inputsequence-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-inputsequence.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-inputsettings-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-inputsettings.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-keyboarddevice-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-keyboarddevice.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-keyboardhandler-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-keyboardhandler.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-keyevent-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-keyevent.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-logicaldevice-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-logicaldevice.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-mousedevice-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-mousedevice.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-mouseevent-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-mouseevent.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-mousehandler-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-mousehandler.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-wheelevent-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-input-wheelevent.html
/usr/share/doc/qt6/qt3d/qml-qt3d-logic-frameaction-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-logic-frameaction.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-abstractraycaster-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-abstractraycaster.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-abstracttexture-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-abstracttexture.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-abstracttextureimage-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-abstracttextureimage.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-alphacoverage-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-alphacoverage.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-alphatest-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-alphatest.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-blendequation-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-blendequation.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-blendequationarguments-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-blendequationarguments.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-blitframebuffer-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-blitframebuffer.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-buffercapture-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-buffercapture.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-camera-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-camera-obsolete.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-camera.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-cameralens-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-cameralens.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-cameraselector-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-cameraselector.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-clearbuffers-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-clearbuffers.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-clipplane-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-clipplane.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-colormask-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-colormask.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-computecommand-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-computecommand.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-cullface-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-cullface.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-debugoverlay-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-debugoverlay.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-depthrange-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-depthrange.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-depthtest-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-depthtest.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-directionallight-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-directionallight.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-dispatchcompute-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-dispatchcompute.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-dithering-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-dithering.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-effect-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-effect.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-environmentlight-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-environmentlight.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-filterkey-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-filterkey.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-framegraphnode-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-framegraphnode.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-frontface-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-frontface.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-frustumculling-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-frustumculling.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-geometryrenderer-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-geometryrenderer.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-graphicsapifilter-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-graphicsapifilter.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-layer-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-layer.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-layerfilter-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-layerfilter.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-levelofdetail-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-levelofdetail.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-levelofdetailboundingsphere-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-levelofdetailboundingsphere.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-levelofdetailloader-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-levelofdetailloader.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-levelofdetailswitch-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-levelofdetailswitch.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-light-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-light.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-linewidth-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-linewidth.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-material-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-material.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-memorybarrier-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-memorybarrier.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-mesh-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-mesh.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-multisampleantialiasing-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-multisampleantialiasing.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-nodepthmask-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-nodepthmask.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-nodraw-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-nodraw.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-nopicking-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-nopicking.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-objectpicker-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-objectpicker.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-parameter-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-parameter.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-pickevent-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-pickevent.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-pickingproxy-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-pickingproxy.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-pickingsettings-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-pickingsettings.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-picklineevent-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-picklineevent.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-pickpointevent-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-pickpointevent.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-picktriangleevent-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-picktriangleevent.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-pointlight-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-pointlight.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-pointsize-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-pointsize.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-polygonoffset-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-polygonoffset.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-proximityfilter-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-proximityfilter.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-rastermode-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-rastermode.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-raycaster-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-raycaster.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-rendercapabilities-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-rendercapabilities.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-rendercapture-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-rendercapture-obsolete.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-rendercapture.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-rendercapturereply-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-rendercapturereply.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-renderpass-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-renderpass.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-renderpassfilter-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-renderpassfilter.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-rendersettings-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-rendersettings.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-renderstate-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-renderstate.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-renderstateset-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-renderstateset.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-rendersurfaceselector-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-rendersurfaceselector.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-rendertarget-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-rendertarget.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-rendertargetoutput-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-rendertargetoutput.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-rendertargetselector-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-rendertargetselector.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-sceneloader-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-sceneloader.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-scissortest-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-scissortest.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-screenraycaster-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-screenraycaster.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-seamlesscubemap-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-seamlesscubemap.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-shaderimage-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-shaderimage.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-shaderprogram-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-shaderprogram.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-shaderprogrambuilder-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-shaderprogrambuilder.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-sharedgltexture-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-sharedgltexture.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-sortpolicy-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-sortpolicy.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-spotlight-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-spotlight.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-stencilmask-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-stencilmask.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-stenciloperation-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-stenciloperation.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-stenciloperationarguments-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-stenciloperationarguments.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-stenciltest-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-stenciltest.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-stenciltestarguments-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-stenciltestarguments.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-subtreeenabler-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-subtreeenabler.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-technique-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-technique.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-techniquefilter-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-techniquefilter.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-texture1d-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-texture1d.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-texture1darray-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-texture1darray.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-texture2d-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-texture2d.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-texture2darray-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-texture2darray.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-texture2dmultisample-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-texture2dmultisample.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-texture2dmultisamplearray-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-texture2dmultisamplearray.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-texture3d-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-texture3d.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-texturebuffer-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-texturebuffer.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-texturecubemap-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-texturecubemap.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-texturecubemaparray-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-texturecubemaparray.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-textureimage-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-textureimage.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-textureloader-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-textureloader.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-texturerectangle-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-texturerectangle.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-viewport-members.html
/usr/share/doc/qt6/qt3d/qml-qt3d-render-viewport.html
/usr/share/doc/qt6/qt3d/qml-qtquick-scene2d-scene2d-members.html
/usr/share/doc/qt6/qt3d/qml-qtquick-scene2d-scene2d.html
/usr/share/doc/qt6/qt3d/qml-qtquick-scene3d-scene3d-members.html
/usr/share/doc/qt6/qt3d/qml-qtquick-scene3d-scene3d.html
/usr/share/doc/qt6/qt3d/qt3d-animation-qmlmodule.html
/usr/share/doc/qt6/qt3d/qt3d-attribution-gltf-wine.html
/usr/share/doc/qt6/qt3d/qt3d-attribution-imgui-proggyclean.html
/usr/share/doc/qt6/qt3d/qt3d-attribution-imgui.html
/usr/share/doc/qt6/qt3d/qt3d-attribution-miramar-sky.html
/usr/share/doc/qt6/qt3d/qt3d-attribution-nasa-jpl.html
/usr/share/doc/qt6/qt3d/qt3d-attribution-solar-system-scope.html
/usr/share/doc/qt6/qt3d/qt3d-attribution-substance-share.html
/usr/share/doc/qt6/qt3d/qt3d-basicshapes-cpp-example.html
/usr/share/doc/qt6/qt3d/qt3d-changes-qt6.html
/usr/share/doc/qt6/qt3d/qt3d-core-qmlmodule.html
/usr/share/doc/qt6/qt3d/qt3d-cpp.html
/usr/share/doc/qt6/qt3d/qt3d-examples.html
/usr/share/doc/qt6/qt3d/qt3d-extras-qmlmodule.html
/usr/share/doc/qt6/qt3d/qt3d-index.html
/usr/share/doc/qt6/qt3d/qt3d-input-qmlmodule.html
/usr/share/doc/qt6/qt3d/qt3d-logic-qmlmodule.html
/usr/share/doc/qt6/qt3d/qt3d-multiviewport-example.html
/usr/share/doc/qt6/qt3d/qt3d-overview.html
/usr/share/doc/qt6/qt3d/qt3d-pbr-materials-example.html
/usr/share/doc/qt6/qt3d/qt3d-qml.html
/usr/share/doc/qt6/qt3d/qt3d-render-qmlmodule.html
/usr/share/doc/qt6/qt3d/qt3d-simple-cpp-example.html
/usr/share/doc/qt6/qt3d/qt3d-simple-qml-example.html
/usr/share/doc/qt6/qt3d/qt3d-simplecustommaterial-example.html
/usr/share/doc/qt6/qt3d/qt3d-wireframe-example.html
/usr/share/doc/qt6/qt3d/qt3d.index
/usr/share/doc/qt6/qt3d/qt3d.qhp
/usr/share/doc/qt6/qt3d/qt3d.qhp.sha1
/usr/share/doc/qt6/qt3d/qt3danimation-module.html
/usr/share/doc/qt6/qt3d/qt3danimation-qabstractanimation-members.html
/usr/share/doc/qt6/qt3d/qt3danimation-qabstractanimation.html
/usr/share/doc/qt6/qt3d/qt3danimation-qabstractanimationclip-members.html
/usr/share/doc/qt6/qt3d/qt3danimation-qabstractanimationclip.html
/usr/share/doc/qt6/qt3d/qt3danimation-qabstractclipanimator-members.html
/usr/share/doc/qt6/qt3d/qt3danimation-qabstractclipanimator.html
/usr/share/doc/qt6/qt3d/qt3danimation-qabstractclipblendnode-members.html
/usr/share/doc/qt6/qt3d/qt3danimation-qabstractclipblendnode.html
/usr/share/doc/qt6/qt3d/qt3danimation-qadditiveclipblend-members.html
/usr/share/doc/qt6/qt3d/qt3danimation-qadditiveclipblend.html
/usr/share/doc/qt6/qt3d/qt3danimation-qanimationaspect-members.html
/usr/share/doc/qt6/qt3d/qt3danimation-qanimationaspect.html
/usr/share/doc/qt6/qt3d/qt3danimation-qanimationcallback-members.html
/usr/share/doc/qt6/qt3d/qt3danimation-qanimationcallback.html
/usr/share/doc/qt6/qt3d/qt3danimation-qanimationclip-members.html
/usr/share/doc/qt6/qt3d/qt3danimation-qanimationclip.html
/usr/share/doc/qt6/qt3d/qt3danimation-qanimationclipdata.html
/usr/share/doc/qt6/qt3d/qt3danimation-qanimationcliploader-members.html
/usr/share/doc/qt6/qt3d/qt3danimation-qanimationcliploader.html
/usr/share/doc/qt6/qt3d/qt3danimation-qanimationcontroller-members.html
/usr/share/doc/qt6/qt3d/qt3danimation-qanimationcontroller.html
/usr/share/doc/qt6/qt3d/qt3danimation-qanimationgroup-members.html
/usr/share/doc/qt6/qt3d/qt3danimation-qanimationgroup.html
/usr/share/doc/qt6/qt3d/qt3danimation-qblendedclipanimator-members.html
/usr/share/doc/qt6/qt3d/qt3danimation-qblendedclipanimator.html
/usr/share/doc/qt6/qt3d/qt3danimation-qcallbackmapping-members.html
/usr/share/doc/qt6/qt3d/qt3danimation-qcallbackmapping.html
/usr/share/doc/qt6/qt3d/qt3danimation-qchannel.html
/usr/share/doc/qt6/qt3d/qt3danimation-qchannelmapper-members.html
/usr/share/doc/qt6/qt3d/qt3danimation-qchannelmapper.html
/usr/share/doc/qt6/qt3d/qt3danimation-qchannelmapping-members.html
/usr/share/doc/qt6/qt3d/qt3danimation-qchannelmapping.html
/usr/share/doc/qt6/qt3d/qt3danimation-qclipanimator-members.html
/usr/share/doc/qt6/qt3d/qt3danimation-qclipanimator.html
/usr/share/doc/qt6/qt3d/qt3danimation-qclipblendvalue-members.html
/usr/share/doc/qt6/qt3d/qt3danimation-qclipblendvalue.html
/usr/share/doc/qt6/qt3d/qt3danimation-qkeyframe.html
/usr/share/doc/qt6/qt3d/qt3danimation-qkeyframeanimation-members.html
/usr/share/doc/qt6/qt3d/qt3danimation-qkeyframeanimation.html
/usr/share/doc/qt6/qt3d/qt3danimation-qlerpclipblend-members.html
/usr/share/doc/qt6/qt3d/qt3danimation-qlerpclipblend.html
/usr/share/doc/qt6/qt3d/qt3danimation-qmorphinganimation-members.html
/usr/share/doc/qt6/qt3d/qt3danimation-qmorphinganimation.html
/usr/share/doc/qt6/qt3d/qt3danimation-qmorphtarget-members.html
/usr/share/doc/qt6/qt3d/qt3danimation-qmorphtarget.html
/usr/share/doc/qt6/qt3d/qt3danimation-qvertexblendanimation-members.html
/usr/share/doc/qt6/qt3d/qt3danimation-qvertexblendanimation.html
/usr/share/doc/qt6/qt3d/qt3danimation.html
/usr/share/doc/qt6/qt3d/qt3dcore-module.html
/usr/share/doc/qt6/qt3d/qt3dcore-qabstractaspect-members.html
/usr/share/doc/qt6/qt3d/qt3dcore-qabstractaspect.html
/usr/share/doc/qt6/qt3d/qt3dcore-qabstractfunctor-members.html
/usr/share/doc/qt6/qt3d/qt3dcore-qabstractfunctor.html
/usr/share/doc/qt6/qt3d/qt3dcore-qabstractskeleton-members.html
/usr/share/doc/qt6/qt3d/qt3dcore-qabstractskeleton.html
/usr/share/doc/qt6/qt3d/qt3dcore-qarmature-members.html
/usr/share/doc/qt6/qt3d/qt3dcore-qarmature.html
/usr/share/doc/qt6/qt3d/qt3dcore-qaspectengine-members.html
/usr/share/doc/qt6/qt3d/qt3dcore-qaspectengine.html
/usr/share/doc/qt6/qt3d/qt3dcore-qaspectjob-members.html
/usr/share/doc/qt6/qt3d/qt3dcore-qaspectjob.html
/usr/share/doc/qt6/qt3d/qt3dcore-qattribute-members.html
/usr/share/doc/qt6/qt3d/qt3dcore-qattribute.html
/usr/share/doc/qt6/qt3d/qt3dcore-qbackendnode-members.html
/usr/share/doc/qt6/qt3d/qt3dcore-qbackendnode.html
/usr/share/doc/qt6/qt3d/qt3dcore-qbackendnodemapper-members.html
/usr/share/doc/qt6/qt3d/qt3dcore-qbackendnodemapper.html
/usr/share/doc/qt6/qt3d/qt3dcore-qboundingvolume-members.html
/usr/share/doc/qt6/qt3d/qt3dcore-qboundingvolume.html
/usr/share/doc/qt6/qt3d/qt3dcore-qbuffer-members.html
/usr/share/doc/qt6/qt3d/qt3dcore-qbuffer.html
/usr/share/doc/qt6/qt3d/qt3dcore-qcomponent-members.html
/usr/share/doc/qt6/qt3d/qt3dcore-qcomponent.html
/usr/share/doc/qt6/qt3d/qt3dcore-qcoresettings-members.html
/usr/share/doc/qt6/qt3d/qt3dcore-qcoresettings.html
/usr/share/doc/qt6/qt3d/qt3dcore-qentity-members.html
/usr/share/doc/qt6/qt3d/qt3dcore-qentity.html
/usr/share/doc/qt6/qt3d/qt3dcore-qgeometry-members.html
/usr/share/doc/qt6/qt3d/qt3dcore-qgeometry.html
/usr/share/doc/qt6/qt3d/qt3dcore-qgeometryview-members.html
/usr/share/doc/qt6/qt3d/qt3dcore-qgeometryview.html
/usr/share/doc/qt6/qt3d/qt3dcore-qjoint-members.html
/usr/share/doc/qt6/qt3d/qt3dcore-qjoint.html
/usr/share/doc/qt6/qt3d/qt3dcore-qnode-members.html
/usr/share/doc/qt6/qt3d/qt3dcore-qnode.html
/usr/share/doc/qt6/qt3d/qt3dcore-qnodeid-members.html
/usr/share/doc/qt6/qt3d/qt3dcore-qnodeid.html
/usr/share/doc/qt6/qt3d/qt3dcore-qskeleton-members.html
/usr/share/doc/qt6/qt3d/qt3dcore-qskeleton.html
/usr/share/doc/qt6/qt3d/qt3dcore-qskeletonloader-members.html
/usr/share/doc/qt6/qt3d/qt3dcore-qskeletonloader.html
/usr/share/doc/qt6/qt3d/qt3dcore-qtransform-members.html
/usr/share/doc/qt6/qt3d/qt3dcore-qtransform.html
/usr/share/doc/qt6/qt3d/qt3dcore-quick-qqmlaspectengine-members.html
/usr/share/doc/qt6/qt3d/qt3dcore-quick-qqmlaspectengine.html
/usr/share/doc/qt6/qt3d/qt3dcore-quick.html
/usr/share/doc/qt6/qt3d/qt3dcore.html
/usr/share/doc/qt6/qt3d/qt3dextras-module.html
/usr/share/doc/qt6/qt3d/qt3dextras-obsolete.html
/usr/share/doc/qt6/qt3d/qt3dextras-qabstractcameracontroller-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qabstractcameracontroller.html
/usr/share/doc/qt6/qt3d/qt3dextras-qconegeometry-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qconegeometry.html
/usr/share/doc/qt6/qt3d/qt3dextras-qconegeometryview-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qconegeometryview.html
/usr/share/doc/qt6/qt3d/qt3dextras-qconemesh-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qconemesh.html
/usr/share/doc/qt6/qt3d/qt3dextras-qcuboidgeometry-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qcuboidgeometry.html
/usr/share/doc/qt6/qt3d/qt3dextras-qcuboidgeometryview-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qcuboidgeometryview.html
/usr/share/doc/qt6/qt3d/qt3dextras-qcuboidmesh-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qcuboidmesh.html
/usr/share/doc/qt6/qt3d/qt3dextras-qcylindergeometry-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qcylindergeometry.html
/usr/share/doc/qt6/qt3d/qt3dextras-qcylindergeometryview-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qcylindergeometryview.html
/usr/share/doc/qt6/qt3d/qt3dextras-qcylindermesh-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qcylindermesh.html
/usr/share/doc/qt6/qt3d/qt3dextras-qdiffusemapmaterial-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qdiffusemapmaterial.html
/usr/share/doc/qt6/qt3d/qt3dextras-qdiffusespecularmapmaterial-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qdiffusespecularmapmaterial.html
/usr/share/doc/qt6/qt3d/qt3dextras-qdiffusespecularmaterial-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qdiffusespecularmaterial.html
/usr/share/doc/qt6/qt3d/qt3dextras-qextrudedtextgeometry-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qextrudedtextgeometry.html
/usr/share/doc/qt6/qt3d/qt3dextras-qextrudedtextmesh-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qextrudedtextmesh.html
/usr/share/doc/qt6/qt3d/qt3dextras-qfirstpersoncameracontroller-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qfirstpersoncameracontroller.html
/usr/share/doc/qt6/qt3d/qt3dextras-qforwardrenderer-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qforwardrenderer-obsolete.html
/usr/share/doc/qt6/qt3d/qt3dextras-qforwardrenderer.html
/usr/share/doc/qt6/qt3d/qt3dextras-qgoochmaterial-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qgoochmaterial.html
/usr/share/doc/qt6/qt3d/qt3dextras-qmetalroughmaterial-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qmetalroughmaterial.html
/usr/share/doc/qt6/qt3d/qt3dextras-qmorphphongmaterial-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qmorphphongmaterial.html
/usr/share/doc/qt6/qt3d/qt3dextras-qnormaldiffusemapalphamaterial-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qnormaldiffusemapalphamaterial.html
/usr/share/doc/qt6/qt3d/qt3dextras-qnormaldiffusemapmaterial-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qnormaldiffusemapmaterial.html
/usr/share/doc/qt6/qt3d/qt3dextras-qnormaldiffusespecularmapmaterial-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qnormaldiffusespecularmapmaterial.html
/usr/share/doc/qt6/qt3d/qt3dextras-qorbitcameracontroller-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qorbitcameracontroller.html
/usr/share/doc/qt6/qt3d/qt3dextras-qpervertexcolormaterial-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qpervertexcolormaterial.html
/usr/share/doc/qt6/qt3d/qt3dextras-qphongalphamaterial-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qphongalphamaterial.html
/usr/share/doc/qt6/qt3d/qt3dextras-qphongmaterial-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qphongmaterial.html
/usr/share/doc/qt6/qt3d/qt3dextras-qplanegeometry-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qplanegeometry.html
/usr/share/doc/qt6/qt3d/qt3dextras-qplanegeometryview-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qplanegeometryview.html
/usr/share/doc/qt6/qt3d/qt3dextras-qplanemesh-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qplanemesh.html
/usr/share/doc/qt6/qt3d/qt3dextras-qskyboxentity-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qskyboxentity.html
/usr/share/doc/qt6/qt3d/qt3dextras-qspheregeometry-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qspheregeometry.html
/usr/share/doc/qt6/qt3d/qt3dextras-qspheregeometryview-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qspheregeometryview.html
/usr/share/doc/qt6/qt3d/qt3dextras-qspheremesh-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qspheremesh.html
/usr/share/doc/qt6/qt3d/qt3dextras-qtext2dentity-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qtext2dentity.html
/usr/share/doc/qt6/qt3d/qt3dextras-qtexturematerial-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qtexturematerial.html
/usr/share/doc/qt6/qt3d/qt3dextras-qtorusgeometry-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qtorusgeometry.html
/usr/share/doc/qt6/qt3d/qt3dextras-qtorusgeometryview-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qtorusgeometryview.html
/usr/share/doc/qt6/qt3d/qt3dextras-qtorusmesh-members.html
/usr/share/doc/qt6/qt3d/qt3dextras-qtorusmesh.html
/usr/share/doc/qt6/qt3d/qt3dextras.html
/usr/share/doc/qt6/qt3d/qt3dinput-module.html
/usr/share/doc/qt6/qt3d/qt3dinput-qabstractactioninput-members.html
/usr/share/doc/qt6/qt3d/qt3dinput-qabstractactioninput.html
/usr/share/doc/qt6/qt3d/qt3dinput-qabstractaxisinput-members.html
/usr/share/doc/qt6/qt3d/qt3dinput-qabstractaxisinput.html
/usr/share/doc/qt6/qt3d/qt3dinput-qabstractphysicaldevice-members.html
/usr/share/doc/qt6/qt3d/qt3dinput-qabstractphysicaldevice.html
/usr/share/doc/qt6/qt3d/qt3dinput-qabstractphysicaldeviceproxy-members.html
/usr/share/doc/qt6/qt3d/qt3dinput-qabstractphysicaldeviceproxy.html
/usr/share/doc/qt6/qt3d/qt3dinput-qaction-members.html
/usr/share/doc/qt6/qt3d/qt3dinput-qaction.html
/usr/share/doc/qt6/qt3d/qt3dinput-qactioninput-members.html
/usr/share/doc/qt6/qt3d/qt3dinput-qactioninput.html
/usr/share/doc/qt6/qt3d/qt3dinput-qanalogaxisinput-members.html
/usr/share/doc/qt6/qt3d/qt3dinput-qanalogaxisinput.html
/usr/share/doc/qt6/qt3d/qt3dinput-qaxis-members.html
/usr/share/doc/qt6/qt3d/qt3dinput-qaxis.html
/usr/share/doc/qt6/qt3d/qt3dinput-qaxisaccumulator-members.html
/usr/share/doc/qt6/qt3d/qt3dinput-qaxisaccumulator.html
/usr/share/doc/qt6/qt3d/qt3dinput-qaxissetting-members.html
/usr/share/doc/qt6/qt3d/qt3dinput-qaxissetting.html
/usr/share/doc/qt6/qt3d/qt3dinput-qbuttonaxisinput-members.html
/usr/share/doc/qt6/qt3d/qt3dinput-qbuttonaxisinput.html
/usr/share/doc/qt6/qt3d/qt3dinput-qinputaspect-members.html
/usr/share/doc/qt6/qt3d/qt3dinput-qinputaspect.html
/usr/share/doc/qt6/qt3d/qt3dinput-qinputchord-members.html
/usr/share/doc/qt6/qt3d/qt3dinput-qinputchord.html
/usr/share/doc/qt6/qt3d/qt3dinput-qinputdeviceintegration-members.html
/usr/share/doc/qt6/qt3d/qt3dinput-qinputdeviceintegration.html
/usr/share/doc/qt6/qt3d/qt3dinput-qinputsequence-members.html
/usr/share/doc/qt6/qt3d/qt3dinput-qinputsequence.html
/usr/share/doc/qt6/qt3d/qt3dinput-qinputsettings-members.html
/usr/share/doc/qt6/qt3d/qt3dinput-qinputsettings.html
/usr/share/doc/qt6/qt3d/qt3dinput-qkeyboarddevice-members.html
/usr/share/doc/qt6/qt3d/qt3dinput-qkeyboarddevice.html
/usr/share/doc/qt6/qt3d/qt3dinput-qkeyboardhandler-members.html
/usr/share/doc/qt6/qt3d/qt3dinput-qkeyboardhandler.html
/usr/share/doc/qt6/qt3d/qt3dinput-qkeyevent-members.html
/usr/share/doc/qt6/qt3d/qt3dinput-qkeyevent.html
/usr/share/doc/qt6/qt3d/qt3dinput-qlogicaldevice-members.html
/usr/share/doc/qt6/qt3d/qt3dinput-qlogicaldevice.html
/usr/share/doc/qt6/qt3d/qt3dinput-qmousedevice-members.html
/usr/share/doc/qt6/qt3d/qt3dinput-qmousedevice.html
/usr/share/doc/qt6/qt3d/qt3dinput-qmouseevent-members.html
/usr/share/doc/qt6/qt3d/qt3dinput-qmouseevent.html
/usr/share/doc/qt6/qt3d/qt3dinput-qmousehandler-members.html
/usr/share/doc/qt6/qt3d/qt3dinput-qmousehandler.html
/usr/share/doc/qt6/qt3d/qt3dinput-qwheelevent-members.html
/usr/share/doc/qt6/qt3d/qt3dinput-qwheelevent.html
/usr/share/doc/qt6/qt3d/qt3dinput.html
/usr/share/doc/qt6/qt3d/qt3dlogic-logic.html
/usr/share/doc/qt6/qt3d/qt3dlogic-module.html
/usr/share/doc/qt6/qt3d/qt3dlogic-qframeaction-members.html
/usr/share/doc/qt6/qt3d/qt3dlogic-qframeaction.html
/usr/share/doc/qt6/qt3d/qt3dlogic-qlogicaspect-members.html
/usr/share/doc/qt6/qt3d/qt3dlogic-qlogicaspect.html
/usr/share/doc/qt6/qt3d/qt3dlogic.html
/usr/share/doc/qt6/qt3d/qt3drender-framegraph.html
/usr/share/doc/qt6/qt3d/qt3drender-geometry.html
/usr/share/doc/qt6/qt3d/qt3drender-module.html
/usr/share/doc/qt6/qt3d/qt3drender-porting-to-rhi.html
/usr/share/doc/qt6/qt3d/qt3drender-protips.html
/usr/share/doc/qt6/qt3d/qt3drender-qabstractlight-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qabstractlight.html
/usr/share/doc/qt6/qt3d/qt3drender-qabstractraycaster-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qabstractraycaster.html
/usr/share/doc/qt6/qt3d/qt3drender-qabstracttexture-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qabstracttexture.html
/usr/share/doc/qt6/qt3d/qt3drender-qabstracttextureimage-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qabstracttextureimage.html
/usr/share/doc/qt6/qt3d/qt3drender-qalphacoverage-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qalphacoverage.html
/usr/share/doc/qt6/qt3d/qt3drender-qalphatest-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qalphatest.html
/usr/share/doc/qt6/qt3d/qt3drender-qblendequation-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qblendequation.html
/usr/share/doc/qt6/qt3d/qt3drender-qblendequationarguments-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qblendequationarguments.html
/usr/share/doc/qt6/qt3d/qt3drender-qblitframebuffer-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qblitframebuffer.html
/usr/share/doc/qt6/qt3d/qt3drender-qbuffercapture-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qbuffercapture.html
/usr/share/doc/qt6/qt3d/qt3drender-qcamera-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qcamera-obsolete.html
/usr/share/doc/qt6/qt3d/qt3drender-qcamera.html
/usr/share/doc/qt6/qt3d/qt3drender-qcameralens-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qcameralens.html
/usr/share/doc/qt6/qt3d/qt3drender-qcameraselector-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qcameraselector.html
/usr/share/doc/qt6/qt3d/qt3drender-qclearbuffers-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qclearbuffers.html
/usr/share/doc/qt6/qt3d/qt3drender-qclipplane-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qclipplane.html
/usr/share/doc/qt6/qt3d/qt3drender-qcolormask-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qcolormask.html
/usr/share/doc/qt6/qt3d/qt3drender-qcomputecommand-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qcomputecommand.html
/usr/share/doc/qt6/qt3d/qt3drender-qcullface-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qcullface.html
/usr/share/doc/qt6/qt3d/qt3drender-qdebugoverlay-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qdebugoverlay.html
/usr/share/doc/qt6/qt3d/qt3drender-qdepthrange-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qdepthrange.html
/usr/share/doc/qt6/qt3d/qt3drender-qdepthtest-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qdepthtest.html
/usr/share/doc/qt6/qt3d/qt3drender-qdirectionallight-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qdirectionallight.html
/usr/share/doc/qt6/qt3d/qt3drender-qdispatchcompute-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qdispatchcompute.html
/usr/share/doc/qt6/qt3d/qt3drender-qdithering-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qdithering.html
/usr/share/doc/qt6/qt3d/qt3drender-qeffect-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qeffect.html
/usr/share/doc/qt6/qt3d/qt3drender-qenvironmentlight-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qenvironmentlight.html
/usr/share/doc/qt6/qt3d/qt3drender-qfilterkey-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qfilterkey.html
/usr/share/doc/qt6/qt3d/qt3drender-qframegraphnode-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qframegraphnode.html
/usr/share/doc/qt6/qt3d/qt3drender-qfrontface-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qfrontface.html
/usr/share/doc/qt6/qt3d/qt3drender-qfrustumculling-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qfrustumculling.html
/usr/share/doc/qt6/qt3d/qt3drender-qgeometryrenderer-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qgeometryrenderer.html
/usr/share/doc/qt6/qt3d/qt3drender-qgraphicsapifilter-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qgraphicsapifilter.html
/usr/share/doc/qt6/qt3d/qt3drender-qlayer-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qlayer.html
/usr/share/doc/qt6/qt3d/qt3drender-qlayerfilter-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qlayerfilter.html
/usr/share/doc/qt6/qt3d/qt3drender-qlevelofdetail-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qlevelofdetail.html
/usr/share/doc/qt6/qt3d/qt3drender-qlevelofdetailboundingsphere-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qlevelofdetailboundingsphere.html
/usr/share/doc/qt6/qt3d/qt3drender-qlevelofdetailswitch-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qlevelofdetailswitch.html
/usr/share/doc/qt6/qt3d/qt3drender-qlinewidth-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qlinewidth.html
/usr/share/doc/qt6/qt3d/qt3drender-qmaterial-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qmaterial.html
/usr/share/doc/qt6/qt3d/qt3drender-qmemorybarrier-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qmemorybarrier.html
/usr/share/doc/qt6/qt3d/qt3drender-qmesh-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qmesh.html
/usr/share/doc/qt6/qt3d/qt3drender-qmultisampleantialiasing-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qmultisampleantialiasing.html
/usr/share/doc/qt6/qt3d/qt3drender-qnodepthmask-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qnodepthmask.html
/usr/share/doc/qt6/qt3d/qt3drender-qnodraw-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qnodraw.html
/usr/share/doc/qt6/qt3d/qt3drender-qnopicking-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qnopicking.html
/usr/share/doc/qt6/qt3d/qt3drender-qobjectpicker-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qobjectpicker.html
/usr/share/doc/qt6/qt3d/qt3drender-qpaintedtextureimage-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qpaintedtextureimage.html
/usr/share/doc/qt6/qt3d/qt3drender-qparameter-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qparameter.html
/usr/share/doc/qt6/qt3d/qt3drender-qpickevent-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qpickevent.html
/usr/share/doc/qt6/qt3d/qt3drender-qpickingproxy-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qpickingproxy.html
/usr/share/doc/qt6/qt3d/qt3drender-qpickingsettings-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qpickingsettings.html
/usr/share/doc/qt6/qt3d/qt3drender-qpicklineevent-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qpicklineevent.html
/usr/share/doc/qt6/qt3d/qt3drender-qpickpointevent-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qpickpointevent.html
/usr/share/doc/qt6/qt3d/qt3drender-qpicktriangleevent-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qpicktriangleevent.html
/usr/share/doc/qt6/qt3d/qt3drender-qpointlight-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qpointlight.html
/usr/share/doc/qt6/qt3d/qt3drender-qpointsize-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qpointsize.html
/usr/share/doc/qt6/qt3d/qt3drender-qpolygonoffset-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qpolygonoffset.html
/usr/share/doc/qt6/qt3d/qt3drender-qproximityfilter-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qproximityfilter.html
/usr/share/doc/qt6/qt3d/qt3drender-qrastermode-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qrastermode.html
/usr/share/doc/qt6/qt3d/qt3drender-qraycaster-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qraycaster.html
/usr/share/doc/qt6/qt3d/qt3drender-qraycasterhit-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qraycasterhit.html
/usr/share/doc/qt6/qt3d/qt3drender-qrenderaspect-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qrenderaspect.html
/usr/share/doc/qt6/qt3d/qt3drender-qrendercapabilities-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qrendercapabilities.html
/usr/share/doc/qt6/qt3d/qt3drender-qrendercapture-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qrendercapture-obsolete.html
/usr/share/doc/qt6/qt3d/qt3drender-qrendercapture.html
/usr/share/doc/qt6/qt3d/qt3drender-qrendercapturereply-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qrendercapturereply.html
/usr/share/doc/qt6/qt3d/qt3drender-qrenderpass-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qrenderpass.html
/usr/share/doc/qt6/qt3d/qt3drender-qrenderpassfilter-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qrenderpassfilter.html
/usr/share/doc/qt6/qt3d/qt3drender-qrendersettings-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qrendersettings.html
/usr/share/doc/qt6/qt3d/qt3drender-qrenderstate-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qrenderstate.html
/usr/share/doc/qt6/qt3d/qt3drender-qrenderstateset-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qrenderstateset.html
/usr/share/doc/qt6/qt3d/qt3drender-qrendersurfaceselector-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qrendersurfaceselector.html
/usr/share/doc/qt6/qt3d/qt3drender-qrendertarget-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qrendertarget.html
/usr/share/doc/qt6/qt3d/qt3drender-qrendertargetoutput-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qrendertargetoutput.html
/usr/share/doc/qt6/qt3d/qt3drender-qrendertargetselector-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qrendertargetselector.html
/usr/share/doc/qt6/qt3d/qt3drender-qsceneloader-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qsceneloader.html
/usr/share/doc/qt6/qt3d/qt3drender-qscissortest-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qscissortest.html
/usr/share/doc/qt6/qt3d/qt3drender-qscreenraycaster-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qscreenraycaster.html
/usr/share/doc/qt6/qt3d/qt3drender-qseamlesscubemap-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qseamlesscubemap.html
/usr/share/doc/qt6/qt3d/qt3drender-qsetfence-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qsetfence.html
/usr/share/doc/qt6/qt3d/qt3drender-qshaderdata-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qshaderdata.html
/usr/share/doc/qt6/qt3d/qt3drender-qshaderimage-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qshaderimage.html
/usr/share/doc/qt6/qt3d/qt3drender-qshaderprogram-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qshaderprogram.html
/usr/share/doc/qt6/qt3d/qt3drender-qshaderprogrambuilder-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qshaderprogrambuilder.html
/usr/share/doc/qt6/qt3d/qt3drender-qsharedgltexture-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qsharedgltexture.html
/usr/share/doc/qt6/qt3d/qt3drender-qsortpolicy-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qsortpolicy.html
/usr/share/doc/qt6/qt3d/qt3drender-qspotlight-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qspotlight.html
/usr/share/doc/qt6/qt3d/qt3drender-qstencilmask-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qstencilmask.html
/usr/share/doc/qt6/qt3d/qt3drender-qstenciloperation-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qstenciloperation.html
/usr/share/doc/qt6/qt3d/qt3drender-qstenciloperationarguments-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qstenciloperationarguments.html
/usr/share/doc/qt6/qt3d/qt3drender-qstenciltest-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qstenciltest.html
/usr/share/doc/qt6/qt3d/qt3drender-qstenciltestarguments-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qstenciltestarguments.html
/usr/share/doc/qt6/qt3d/qt3drender-qsubtreeenabler-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qsubtreeenabler.html
/usr/share/doc/qt6/qt3d/qt3drender-qtechnique-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qtechnique.html
/usr/share/doc/qt6/qt3d/qt3drender-qtechniquefilter-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qtechniquefilter.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexture1d-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexture1d.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexture1darray-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexture1darray.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexture2d-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexture2d.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexture2darray-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexture2darray.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexture2dmultisample-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexture2dmultisample.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexture2dmultisamplearray-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexture2dmultisamplearray.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexture3d-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexture3d.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexturebuffer-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexturebuffer.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexturecubemap-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexturecubemap.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexturecubemaparray-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexturecubemaparray.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexturedata-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexturedata.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexturedataupdate.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexturegenerator-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexturegenerator.html
/usr/share/doc/qt6/qt3d/qt3drender-qtextureimage-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qtextureimage.html
/usr/share/doc/qt6/qt3d/qt3drender-qtextureimagedata-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qtextureimagedata.html
/usr/share/doc/qt6/qt3d/qt3drender-qtextureimagedatagenerator-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qtextureimagedatagenerator.html
/usr/share/doc/qt6/qt3d/qt3drender-qtextureloader-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qtextureloader.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexturerectangle-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexturerectangle.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexturewrapmode-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qtexturewrapmode.html
/usr/share/doc/qt6/qt3d/qt3drender-quick-qscene2d-members.html
/usr/share/doc/qt6/qt3d/qt3drender-quick-qscene2d.html
/usr/share/doc/qt6/qt3d/qt3drender-quick.html
/usr/share/doc/qt6/qt3d/qt3drender-qviewport-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qviewport.html
/usr/share/doc/qt6/qt3d/qt3drender-qwaitfence-members.html
/usr/share/doc/qt6/qt3d/qt3drender-qwaitfence.html
/usr/share/doc/qt6/qt3d/qt3drender-render.html
/usr/share/doc/qt6/qt3d/qt3drender.html
/usr/share/doc/qt6/qt3d/qt3dscene2d-module.html
/usr/share/doc/qt6/qt3d/qtquick-scene2d-qmlmodule.html
/usr/share/doc/qt6/qt3d/qtquick-scene3d-qmlmodule.html
/usr/share/doc/qt6/qt3d/style
/usr/share/doc/qt6/qt3d/style/offline-dark.css
/usr/share/doc/qt6/qt3d/style/offline-simple.css
/usr/share/doc/qt6/qt3d/style/offline.css
/usr/share/doc/qt6/qtassistant/assistant-custom-help-viewer.html
/usr/share/doc/qt6/qtassistant/assistant-details.html
/usr/share/doc/qt6/qtassistant/assistant-licenses.html
/usr/share/doc/qt6/qtassistant/assistant-quick-guide.html
/usr/share/doc/qt6/qtassistant/examples-manifest.xml
/usr/share/doc/qt6/qtassistant/examples-qtassistant.html
/usr/share/doc/qt6/qtassistant/images
/usr/share/doc/qt6/qtassistant/images/arrow_bc.png
/usr/share/doc/qt6/qtassistant/images/assistant-assistant.png
/usr/share/doc/qt6/qtassistant/images/assistant-bookmarks.png
/usr/share/doc/qt6/qtassistant/images/assistant-dockwidgets.png
/usr/share/doc/qt6/qtassistant/images/assistant-examples.png
/usr/share/doc/qt6/qtassistant/images/assistant-index.png
/usr/share/doc/qt6/qtassistant/images/assistant-preferences-documentation.png
/usr/share/doc/qt6/qtassistant/images/assistant-preferences-filters.png
/usr/share/doc/qt6/qtassistant/images/assistant-preferences-fonts.png
/usr/share/doc/qt6/qtassistant/images/assistant-preferences-options.png
/usr/share/doc/qt6/qtassistant/images/assistant-search.png
/usr/share/doc/qt6/qtassistant/images/bgrContent.png
/usr/share/doc/qt6/qtassistant/images/btn_next.png
/usr/share/doc/qt6/qtassistant/images/btn_prev.png
/usr/share/doc/qt6/qtassistant/images/bullet_dn.png
/usr/share/doc/qt6/qtassistant/images/bullet_sq.png
/usr/share/doc/qt6/qtassistant/images/home.png
/usr/share/doc/qt6/qtassistant/images/ico_note.png
/usr/share/doc/qt6/qtassistant/images/ico_note_attention.png
/usr/share/doc/qt6/qtassistant/images/ico_out.png
/usr/share/doc/qt6/qtassistant/images/logo.png
/usr/share/doc/qt6/qtassistant/images/simpletextviewer-example.png
/usr/share/doc/qt6/qtassistant/images/simpletextviewer-findfiledialog.png
/usr/share/doc/qt6/qtassistant/images/simpletextviewer-mainwindow.png
/usr/share/doc/qt6/qtassistant/qtassistant-attribution-litehtml-gumbo.html
/usr/share/doc/qt6/qtassistant/qtassistant-attribution-litehtml.html
/usr/share/doc/qt6/qtassistant/qtassistant-index.html
/usr/share/doc/qt6/qtassistant/qtassistant-remotecontrol-example.html
/usr/share/doc/qt6/qtassistant/qtassistant-simpletextviewer-example.html
/usr/share/doc/qt6/qtassistant/qtassistant.index
/usr/share/doc/qt6/qtassistant/qtassistant.qhp
/usr/share/doc/qt6/qtassistant/qtassistant.qhp.sha1
/usr/share/doc/qt6/qtassistant/style
/usr/share/doc/qt6/qtassistant/style/offline-dark.css
/usr/share/doc/qt6/qtassistant/style/offline-simple.css
/usr/share/doc/qt6/qtassistant/style/offline.css
/usr/share/doc/qt6/qtbluetooth/bluetooth-examples.html
/usr/share/doc/qt6/qtbluetooth/examples-manifest.xml
/usr/share/doc/qt6/qtbluetooth/images
/usr/share/doc/qt6/qtbluetooth/images/arrow_bc.png
/usr/share/doc/qt6/qtbluetooth/images/bgrContent.png
/usr/share/doc/qt6/qtbluetooth/images/btchat-example.png
/usr/share/doc/qt6/qtbluetooth/images/btn_next.png
/usr/share/doc/qt6/qtbluetooth/images/btn_prev.png
/usr/share/doc/qt6/qtbluetooth/images/bullet_dn.png
/usr/share/doc/qt6/qtbluetooth/images/bullet_sq.png
/usr/share/doc/qt6/qtbluetooth/images/heartgame-result.webp
/usr/share/doc/qt6/qtbluetooth/images/heartgame-running.webp
/usr/share/doc/qt6/qtbluetooth/images/heartgame-search.webp
/usr/share/doc/qt6/qtbluetooth/images/heartgame-start.webp
/usr/share/doc/qt6/qtbluetooth/images/home.png
/usr/share/doc/qt6/qtbluetooth/images/ico_note.png
/usr/share/doc/qt6/qtbluetooth/images/ico_note_attention.png
/usr/share/doc/qt6/qtbluetooth/images/ico_out.png
/usr/share/doc/qt6/qtbluetooth/images/logo.png
/usr/share/doc/qt6/qtbluetooth/images/lowenergyscanner-chars.png
/usr/share/doc/qt6/qtbluetooth/images/lowenergyscanner-devices.png
/usr/share/doc/qt6/qtbluetooth/images/lowenergyscanner-services.png
/usr/share/doc/qt6/qtbluetooth/images/peripheral-structure.png
/usr/share/doc/qt6/qtbluetooth/qbluetooth.html
/usr/share/doc/qt6/qtbluetooth/qbluetoothaddress-members.html
/usr/share/doc/qt6/qtbluetooth/qbluetoothaddress.html
/usr/share/doc/qt6/qtbluetooth/qbluetoothdevicediscoveryagent-members.html
/usr/share/doc/qt6/qtbluetooth/qbluetoothdevicediscoveryagent.html
/usr/share/doc/qt6/qtbluetooth/qbluetoothdeviceinfo-members.html
/usr/share/doc/qt6/qtbluetooth/qbluetoothdeviceinfo.html
/usr/share/doc/qt6/qtbluetooth/qbluetoothhostinfo-members.html
/usr/share/doc/qt6/qtbluetooth/qbluetoothhostinfo.html
/usr/share/doc/qt6/qtbluetooth/qbluetoothlocaldevice-members.html
/usr/share/doc/qt6/qtbluetooth/qbluetoothlocaldevice.html
/usr/share/doc/qt6/qtbluetooth/qbluetoothserver-members.html
/usr/share/doc/qt6/qtbluetooth/qbluetoothserver.html
/usr/share/doc/qt6/qtbluetooth/qbluetoothservicediscoveryagent-members.html
/usr/share/doc/qt6/qtbluetooth/qbluetoothservicediscoveryagent.html
/usr/share/doc/qt6/qtbluetooth/qbluetoothserviceinfo-alternative-members.html
/usr/share/doc/qt6/qtbluetooth/qbluetoothserviceinfo-alternative.html
/usr/share/doc/qt6/qtbluetooth/qbluetoothserviceinfo-members.html
/usr/share/doc/qt6/qtbluetooth/qbluetoothserviceinfo-sequence-members.html
/usr/share/doc/qt6/qtbluetooth/qbluetoothserviceinfo-sequence.html
/usr/share/doc/qt6/qtbluetooth/qbluetoothserviceinfo.html
/usr/share/doc/qt6/qtbluetooth/qbluetoothsocket-members.html
/usr/share/doc/qt6/qtbluetooth/qbluetoothsocket.html
/usr/share/doc/qt6/qtbluetooth/qbluetoothuuid-members.html
/usr/share/doc/qt6/qtbluetooth/qbluetoothuuid.html
/usr/share/doc/qt6/qtbluetooth/qlowenergyadvertisingdata-members.html
/usr/share/doc/qt6/qtbluetooth/qlowenergyadvertisingdata.html
/usr/share/doc/qt6/qtbluetooth/qlowenergyadvertisingparameters-addressinfo-members.html
/usr/share/doc/qt6/qtbluetooth/qlowenergyadvertisingparameters-addressinfo.html
/usr/share/doc/qt6/qtbluetooth/qlowenergyadvertisingparameters-members.html
/usr/share/doc/qt6/qtbluetooth/qlowenergyadvertisingparameters.html
/usr/share/doc/qt6/qtbluetooth/qlowenergycharacteristic-members.html
/usr/share/doc/qt6/qtbluetooth/qlowenergycharacteristic.html
/usr/share/doc/qt6/qtbluetooth/qlowenergycharacteristicdata-members.html
/usr/share/doc/qt6/qtbluetooth/qlowenergycharacteristicdata.html
/usr/share/doc/qt6/qtbluetooth/qlowenergyconnectionparameters-members.html
/usr/share/doc/qt6/qtbluetooth/qlowenergyconnectionparameters.html
/usr/share/doc/qt6/qtbluetooth/qlowenergycontroller-members.html
/usr/share/doc/qt6/qtbluetooth/qlowenergycontroller.html
/usr/share/doc/qt6/qtbluetooth/qlowenergydescriptor-members.html
/usr/share/doc/qt6/qtbluetooth/qlowenergydescriptor.html
/usr/share/doc/qt6/qtbluetooth/qlowenergydescriptordata-members.html
/usr/share/doc/qt6/qtbluetooth/qlowenergydescriptordata.html
/usr/share/doc/qt6/qtbluetooth/qlowenergyservice-members.html
/usr/share/doc/qt6/qtbluetooth/qlowenergyservice.html
/usr/share/doc/qt6/qtbluetooth/qlowenergyservicedata-members.html
/usr/share/doc/qt6/qtbluetooth/qlowenergyservicedata.html
/usr/share/doc/qt6/qtbluetooth/qtbluetooth-attribution-bluez.html
/usr/share/doc/qt6/qtbluetooth/qtbluetooth-btchat-example.html
/usr/share/doc/qt6/qtbluetooth/qtbluetooth-changes-qt6.html
/usr/share/doc/qt6/qtbluetooth/qtbluetooth-heartrate-game-example.html
/usr/share/doc/qt6/qtbluetooth/qtbluetooth-heartrate-server-example.html
/usr/share/doc/qt6/qtbluetooth/qtbluetooth-index.html
/usr/share/doc/qt6/qtbluetooth/qtbluetooth-le-overview.html
/usr/share/doc/qt6/qtbluetooth/qtbluetooth-lowenergyscanner-example.html
/usr/share/doc/qt6/qtbluetooth/qtbluetooth-module.html
/usr/share/doc/qt6/qtbluetooth/qtbluetooth-overview.html
/usr/share/doc/qt6/qtbluetooth/qtbluetooth.index
/usr/share/doc/qt6/qtbluetooth/qtbluetooth.qhp
/usr/share/doc/qt6/qtbluetooth/qtbluetooth.qhp.sha1
/usr/share/doc/qt6/qtbluetooth/style
/usr/share/doc/qt6/qtbluetooth/style/offline-dark.css
/usr/share/doc/qt6/qtbluetooth/style/offline-simple.css
/usr/share/doc/qt6/qtbluetooth/style/offline.css
/usr/share/doc/qt6/qtcharts/examples-manifest.xml
/usr/share/doc/qt6/qtcharts/images
/usr/share/doc/qt6/qtcharts/images/ChartWidgetGallery.png
/usr/share/doc/qt6/qtcharts/images/QMLChartsGallery.png
/usr/share/doc/qt6/qtcharts/images/api_category_axis.png
/usr/share/doc/qt6/qtcharts/images/api_datatime_axis.png
/usr/share/doc/qt6/qtcharts/images/arrow_bc.png
/usr/share/doc/qt6/qtcharts/images/bgrContent.png
/usr/share/doc/qt6/qtcharts/images/btn_next.png
/usr/share/doc/qt6/qtcharts/images/btn_prev.png
/usr/share/doc/qt6/qtcharts/images/bullet_dn.png
/usr/share/doc/qt6/qtcharts/images/bullet_sq.png
/usr/share/doc/qt6/qtcharts/images/dynamicwavform.gif
/usr/share/doc/qt6/qtcharts/images/examples_areachart.png
/usr/share/doc/qt6/qtcharts/images/examples_audio.png
/usr/share/doc/qt6/qtcharts/images/examples_barchart.png
/usr/share/doc/qt6/qtcharts/images/examples_barmodelmapper.png
/usr/share/doc/qt6/qtcharts/images/examples_boxplotchart.png
/usr/share/doc/qt6/qtcharts/images/examples_callout.png
/usr/share/doc/qt6/qtcharts/images/examples_candlestickchart.png
/usr/share/doc/qt6/qtcharts/images/examples_chartthemes_blue_cerulean.png
/usr/share/doc/qt6/qtcharts/images/examples_chartthemes_brown_sand.png
/usr/share/doc/qt6/qtcharts/images/examples_chartthemes_light.png
/usr/share/doc/qt6/qtcharts/images/examples_customchart.png
/usr/share/doc/qt6/qtcharts/images/examples_datetimeaxis.png
/usr/share/doc/qt6/qtcharts/images/examples_donutbreakdown.png
/usr/share/doc/qt6/qtcharts/images/examples_donutchart.png
/usr/share/doc/qt6/qtcharts/images/examples_horizontalbarchart.png
/usr/share/doc/qt6/qtcharts/images/examples_horizontalpercentbarchart.png
/usr/share/doc/qt6/qtcharts/images/examples_horizontalstackedbarchart.png
/usr/share/doc/qt6/qtcharts/images/examples_legend_detach.png
/usr/share/doc/qt6/qtcharts/images/examples_legend_detach2.png
/usr/share/doc/qt6/qtcharts/images/examples_legendmarkers.png
/usr/share/doc/qt6/qtcharts/images/examples_lineandbar.png
/usr/share/doc/qt6/qtcharts/images/examples_linechart.png
/usr/share/doc/qt6/qtcharts/images/examples_logvalueaxis.png
/usr/share/doc/qt6/qtcharts/images/examples_modeldata.png
/usr/share/doc/qt6/qtcharts/images/examples_multiaxis.png
/usr/share/doc/qt6/qtcharts/images/examples_nesteddonuts.png
/usr/share/doc/qt6/qtcharts/images/examples_openglseries.png
/usr/share/doc/qt6/qtcharts/images/examples_percentbarchart.png
/usr/share/doc/qt6/qtcharts/images/examples_percentbarchart_legend.png
/usr/share/doc/qt6/qtcharts/images/examples_piechart.png
/usr/share/doc/qt6/qtcharts/images/examples_pointconfiguration.png
/usr/share/doc/qt6/qtcharts/images/examples_pointsselectionandmarkers1.png
/usr/share/doc/qt6/qtcharts/images/examples_pointsselectionandmarkers2.png
/usr/share/doc/qt6/qtcharts/images/examples_polarchart.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlaxes1.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlaxes2.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlaxes3.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlboxplot.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlcandlestick.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlchart1.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlchart10.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlchart11.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlchart12.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlchart2.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlchart3.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlchart4.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlchart5.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlchart6.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlchart7.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlchart8.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlchart9.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlcustomizations.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlcustomlegend1.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlcustomlegend2.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlcustomlegend3.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlf1legends.png
/usr/share/doc/qt6/qtcharts/images/examples_qmloscilloscope.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlpolarchart1.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlpolarchart2.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlpolarchart3.png
/usr/share/doc/qt6/qtcharts/images/examples_qmlweather.png
/usr/share/doc/qt6/qtcharts/images/examples_scatterchart.png
/usr/share/doc/qt6/qtcharts/images/examples_selectedbar.png
/usr/share/doc/qt6/qtcharts/images/examples_splinechart.png
/usr/share/doc/qt6/qtcharts/images/examples_stackedbarchart.png
/usr/share/doc/qt6/qtcharts/images/examples_stackedbarchartdrilldown1.png
/usr/share/doc/qt6/qtcharts/images/examples_stackedbarchartdrilldown2.png
/usr/share/doc/qt6/qtcharts/images/examples_temperaturerecords.png
/usr/share/doc/qt6/qtcharts/images/examples_zoomlinechart1.png
/usr/share/doc/qt6/qtcharts/images/examples_zoomlinechart2.png
/usr/share/doc/qt6/qtcharts/images/home.png
/usr/share/doc/qt6/qtcharts/images/ico_note.png
/usr/share/doc/qt6/qtcharts/images/ico_note_attention.png
/usr/share/doc/qt6/qtcharts/images/ico_out.png
/usr/share/doc/qt6/qtcharts/images/logo.png
/usr/share/doc/qt6/qtcharts/images/xyseries_point_configuration.png
/usr/share/doc/qt6/qtcharts/qabstractaxis-members.html
/usr/share/doc/qt6/qtcharts/qabstractaxis.html
/usr/share/doc/qt6/qtcharts/qabstractbarseries-members.html
/usr/share/doc/qt6/qtcharts/qabstractbarseries.html
/usr/share/doc/qt6/qtcharts/qabstractseries-members.html
/usr/share/doc/qt6/qtcharts/qabstractseries.html
/usr/share/doc/qt6/qtcharts/qarealegendmarker-members.html
/usr/share/doc/qt6/qtcharts/qarealegendmarker.html
/usr/share/doc/qt6/qtcharts/qareaseries-members.html
/usr/share/doc/qt6/qtcharts/qareaseries.html
/usr/share/doc/qt6/qtcharts/qbarcategoryaxis-members.html
/usr/share/doc/qt6/qtcharts/qbarcategoryaxis.html
/usr/share/doc/qt6/qtcharts/qbarlegendmarker-members.html
/usr/share/doc/qt6/qtcharts/qbarlegendmarker.html
/usr/share/doc/qt6/qtcharts/qbarseries-members.html
/usr/share/doc/qt6/qtcharts/qbarseries.html
/usr/share/doc/qt6/qtcharts/qbarset-members.html
/usr/share/doc/qt6/qtcharts/qbarset.html
/usr/share/doc/qt6/qtcharts/qboxplotlegendmarker-members.html
/usr/share/doc/qt6/qtcharts/qboxplotlegendmarker.html
/usr/share/doc/qt6/qtcharts/qboxplotseries-members.html
/usr/share/doc/qt6/qtcharts/qboxplotseries.html
/usr/share/doc/qt6/qtcharts/qboxset-members.html
/usr/share/doc/qt6/qtcharts/qboxset.html
/usr/share/doc/qt6/qtcharts/qcandlesticklegendmarker-members.html
/usr/share/doc/qt6/qtcharts/qcandlesticklegendmarker.html
/usr/share/doc/qt6/qtcharts/qcandlestickmodelmapper-members.html
/usr/share/doc/qt6/qtcharts/qcandlestickmodelmapper.html
/usr/share/doc/qt6/qtcharts/qcandlestickseries-members.html
/usr/share/doc/qt6/qtcharts/qcandlestickseries.html
/usr/share/doc/qt6/qtcharts/qcandlestickset-members.html
/usr/share/doc/qt6/qtcharts/qcandlestickset.html
/usr/share/doc/qt6/qtcharts/qcategoryaxis-members.html
/usr/share/doc/qt6/qtcharts/qcategoryaxis.html
/usr/share/doc/qt6/qtcharts/qchart-members.html
/usr/share/doc/qt6/qtcharts/qchart-obsolete.html
/usr/share/doc/qt6/qtcharts/qchart.html
/usr/share/doc/qt6/qtcharts/qchartview-members.html
/usr/share/doc/qt6/qtcharts/qchartview.html
/usr/share/doc/qt6/qtcharts/qcoloraxis-members.html
/usr/share/doc/qt6/qtcharts/qcoloraxis.html
/usr/share/doc/qt6/qtcharts/qdatetimeaxis-members.html
/usr/share/doc/qt6/qtcharts/qdatetimeaxis.html
/usr/share/doc/qt6/qtcharts/qhbarmodelmapper-members.html
/usr/share/doc/qt6/qtcharts/qhbarmodelmapper.html
/usr/share/doc/qt6/qtcharts/qhboxplotmodelmapper-members.html
/usr/share/doc/qt6/qtcharts/qhboxplotmodelmapper.html
/usr/share/doc/qt6/qtcharts/qhcandlestickmodelmapper-members.html
/usr/share/doc/qt6/qtcharts/qhcandlestickmodelmapper.html
/usr/share/doc/qt6/qtcharts/qhorizontalbarseries-members.html
/usr/share/doc/qt6/qtcharts/qhorizontalbarseries.html
/usr/share/doc/qt6/qtcharts/qhorizontalpercentbarseries-members.html
/usr/share/doc/qt6/qtcharts/qhorizontalpercentbarseries.html
/usr/share/doc/qt6/qtcharts/qhorizontalstackedbarseries-members.html
/usr/share/doc/qt6/qtcharts/qhorizontalstackedbarseries.html
/usr/share/doc/qt6/qtcharts/qhpiemodelmapper-members.html
/usr/share/doc/qt6/qtcharts/qhpiemodelmapper.html
/usr/share/doc/qt6/qtcharts/qhxymodelmapper-members.html
/usr/share/doc/qt6/qtcharts/qhxymodelmapper.html
/usr/share/doc/qt6/qtcharts/qlegend-members.html
/usr/share/doc/qt6/qtcharts/qlegend.html
/usr/share/doc/qt6/qtcharts/qlegendmarker-members.html
/usr/share/doc/qt6/qtcharts/qlegendmarker.html
/usr/share/doc/qt6/qtcharts/qlineseries-members.html
/usr/share/doc/qt6/qtcharts/qlineseries.html
/usr/share/doc/qt6/qtcharts/qlogvalueaxis-members.html
/usr/share/doc/qt6/qtcharts/qlogvalueaxis.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-abstractaxis-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-abstractaxis.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-abstractbarseries-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-abstractbarseries.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-abstractseries-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-abstractseries.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-areaseries-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-areaseries.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-barcategoryaxis-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-barcategoryaxis.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-barseries-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-barseries.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-barset-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-barset.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-boxplotseries-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-boxplotseries.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-boxset-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-boxset.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-candlestickseries-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-candlestickseries.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-candlestickset-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-candlestickset.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-categoryaxis-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-categoryaxis.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-categoryrange-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-categoryrange.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-chartview-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-chartview.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-datetimeaxis-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-datetimeaxis.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-hbarmodelmapper-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-hbarmodelmapper.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-hboxplotmodelmapper-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-hboxplotmodelmapper.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-hcandlestickmodelmapper-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-hcandlestickmodelmapper.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-horizontalbarseries-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-horizontalbarseries.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-horizontalpercentbarseries-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-horizontalpercentbarseries.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-horizontalstackedbarseries-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-horizontalstackedbarseries.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-hpiemodelmapper-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-hpiemodelmapper.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-hxymodelmapper-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-hxymodelmapper.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-legend-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-legend.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-lineseries-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-lineseries.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-logvalueaxis-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-logvalueaxis.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-margins-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-margins.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-percentbarseries-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-percentbarseries.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-pieseries-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-pieseries.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-pieslice-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-pieslice.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-polarchartview-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-polarchartview.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-scatterseries-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-scatterseries.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-splineseries-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-splineseries.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-stackedbarseries-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-stackedbarseries.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-valueaxis-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-valueaxis.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-vbarmodelmapper-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-vbarmodelmapper.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-vboxplotmodelmapper-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-vboxplotmodelmapper.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-vcandlestickmodelmapper-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-vcandlestickmodelmapper.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-vpiemodelmapper-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-vpiemodelmapper.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-vxymodelmapper-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-vxymodelmapper.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-xypoint-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-xypoint.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-xyseries-members.html
/usr/share/doc/qt6/qtcharts/qml-qtcharts-xyseries.html
/usr/share/doc/qt6/qtcharts/qpercentbarseries-members.html
/usr/share/doc/qt6/qtcharts/qpercentbarseries.html
/usr/share/doc/qt6/qtcharts/qpielegendmarker-members.html
/usr/share/doc/qt6/qtcharts/qpielegendmarker.html
/usr/share/doc/qt6/qtcharts/qpieseries-members.html
/usr/share/doc/qt6/qtcharts/qpieseries.html
/usr/share/doc/qt6/qtcharts/qpieslice-members.html
/usr/share/doc/qt6/qtcharts/qpieslice.html
/usr/share/doc/qt6/qtcharts/qpolarchart-members.html
/usr/share/doc/qt6/qtcharts/qpolarchart.html
/usr/share/doc/qt6/qtcharts/qscatterseries-members.html
/usr/share/doc/qt6/qtcharts/qscatterseries.html
/usr/share/doc/qt6/qtcharts/qsplineseries-members.html
/usr/share/doc/qt6/qtcharts/qsplineseries.html
/usr/share/doc/qt6/qtcharts/qstackedbarseries-members.html
/usr/share/doc/qt6/qtcharts/qstackedbarseries.html
/usr/share/doc/qt6/qtcharts/qtcharts-areachart-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-audio-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-barchart-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-barmodelmapper-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-boxplotchart-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-callout-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-candlestickchart-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-changes-qt6.html
/usr/share/doc/qt6/qtcharts/qtcharts-chartsgallery-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-chartthemes-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-customchart-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-datetimeaxis-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-donutbreakdown-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-examples.html
/usr/share/doc/qt6/qtcharts/qtcharts-horizontalbarchart-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-horizontalpercentbarchart-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-horizontalstackedbarchart-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-index.html
/usr/share/doc/qt6/qtcharts/qtcharts-legend-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-legendmarkers-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-lineandbar-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-linechart-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-logvalueaxis-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-modeldata-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-module.html
/usr/share/doc/qt6/qtcharts/qtcharts-multiaxis-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-nesteddonuts-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-openglseries-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-overview.html
/usr/share/doc/qt6/qtcharts/qtcharts-percentbarchart-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-pointconfiguration-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-pointsselectionandmarkers-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-polarchart-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-qmlaxes-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-qmlchartsgallery-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-qmlcustomizations-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-qmlcustomlegend-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-qmlf1legends-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-qmlmodule.html
/usr/share/doc/qt6/qtcharts/qtcharts-qmloscilloscope-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-qmlpolarchart-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-qmlweather-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-scatterchart-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-selectedbar-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-splinechart-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-stackedbarchart-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-temperaturerecords-example.html
/usr/share/doc/qt6/qtcharts/qtcharts-zoomlinechart-example.html
/usr/share/doc/qt6/qtcharts/qtcharts.index
/usr/share/doc/qt6/qtcharts/qtcharts.qhp
/usr/share/doc/qt6/qtcharts/qtcharts.qhp.sha1
/usr/share/doc/qt6/qtcharts/qvalueaxis-members.html
/usr/share/doc/qt6/qtcharts/qvalueaxis.html
/usr/share/doc/qt6/qtcharts/qvbarmodelmapper-members.html
/usr/share/doc/qt6/qtcharts/qvbarmodelmapper.html
/usr/share/doc/qt6/qtcharts/qvboxplotmodelmapper-members.html
/usr/share/doc/qt6/qtcharts/qvboxplotmodelmapper.html
/usr/share/doc/qt6/qtcharts/qvcandlestickmodelmapper-members.html
/usr/share/doc/qt6/qtcharts/qvcandlestickmodelmapper.html
/usr/share/doc/qt6/qtcharts/qvpiemodelmapper-members.html
/usr/share/doc/qt6/qtcharts/qvpiemodelmapper.html
/usr/share/doc/qt6/qtcharts/qvxymodelmapper-members.html
/usr/share/doc/qt6/qtcharts/qvxymodelmapper.html
/usr/share/doc/qt6/qtcharts/qxylegendmarker-members.html
/usr/share/doc/qt6/qtcharts/qxylegendmarker.html
/usr/share/doc/qt6/qtcharts/qxyseries-members.html
/usr/share/doc/qt6/qtcharts/qxyseries-obsolete.html
/usr/share/doc/qt6/qtcharts/qxyseries.html
/usr/share/doc/qt6/qtcharts/stackedbarchartdrilldown.html
/usr/share/doc/qt6/qtcharts/style
/usr/share/doc/qt6/qtcharts/style/offline-dark.css
/usr/share/doc/qt6/qtcharts/style/offline-simple.css
/usr/share/doc/qt6/qtcharts/style/offline.css
/usr/share/doc/qt6/qtcmake/cmake-build-on-cmdline.html
/usr/share/doc/qt6/qtcmake/cmake-build-qml-application.html
/usr/share/doc/qt6/qtcmake/cmake-build-reusable-qml-module.html
/usr/share/doc/qt6/qtcmake/cmake-command-reference.html
/usr/share/doc/qt6/qtcmake/cmake-deployment.html
/usr/share/doc/qt6/qtcmake/cmake-get-started.html
/usr/share/doc/qt6/qtcmake/cmake-imported-targets.html
/usr/share/doc/qt6/qtcmake/cmake-manual.html
/usr/share/doc/qt6/qtcmake/cmake-property-reference.html
/usr/share/doc/qt6/qtcmake/cmake-qt5-and-qt6-compatibility.html
/usr/share/doc/qt6/qtcmake/cmake-variable-reference.html
/usr/share/doc/qt6/qtcmake/images
/usr/share/doc/qt6/qtcmake/images/arrow_bc.png
/usr/share/doc/qt6/qtcmake/images/bgrContent.png
/usr/share/doc/qt6/qtcmake/images/btn_next.png
/usr/share/doc/qt6/qtcmake/images/btn_prev.png
/usr/share/doc/qt6/qtcmake/images/bullet_dn.png
/usr/share/doc/qt6/qtcmake/images/bullet_sq.png
/usr/share/doc/qt6/qtcmake/images/home.png
/usr/share/doc/qt6/qtcmake/images/ico_note.png
/usr/share/doc/qt6/qtcmake/images/ico_note_attention.png
/usr/share/doc/qt6/qtcmake/images/ico_out.png
/usr/share/doc/qt6/qtcmake/images/logo.png
/usr/share/doc/qt6/qtcmake/qt-cmake-policies.html
/usr/share/doc/qt6/qtcmake/qtcmake.index
/usr/share/doc/qt6/qtcmake/qtcmake.qhp
/usr/share/doc/qt6/qtcmake/qtcmake.qhp.sha1
/usr/share/doc/qt6/qtcmake/style
/usr/share/doc/qt6/qtcmake/style/offline-dark.css
/usr/share/doc/qt6/qtcmake/style/offline-simple.css
/usr/share/doc/qt6/qtcmake/style/offline.css
/usr/share/doc/qt6/qtcoap/examples-manifest.xml
/usr/share/doc/qt6/qtcoap/images
/usr/share/doc/qt6/qtcoap/images/arrow_bc.png
/usr/share/doc/qt6/qtcoap/images/bgrContent.png
/usr/share/doc/qt6/qtcoap/images/btn_next.png
/usr/share/doc/qt6/qtcoap/images/btn_prev.png
/usr/share/doc/qt6/qtcoap/images/bullet_dn.png
/usr/share/doc/qt6/qtcoap/images/bullet_sq.png
/usr/share/doc/qt6/qtcoap/images/home.png
/usr/share/doc/qt6/qtcoap/images/ico_note.png
/usr/share/doc/qt6/qtcoap/images/ico_note_attention.png
/usr/share/doc/qt6/qtcoap/images/ico_out.png
/usr/share/doc/qt6/qtcoap/images/logo.png
/usr/share/doc/qt6/qtcoap/images/quickmulticastclient.webp
/usr/share/doc/qt6/qtcoap/images/quicksecureclient.png
/usr/share/doc/qt6/qtcoap/images/simplecoapclient.webp
/usr/share/doc/qt6/qtcoap/qcoapclient-members.html
/usr/share/doc/qt6/qtcoap/qcoapclient.html
/usr/share/doc/qt6/qtcoap/qcoapmessage-members.html
/usr/share/doc/qt6/qtcoap/qcoapmessage.html
/usr/share/doc/qt6/qtcoap/qcoapoption-members.html
/usr/share/doc/qt6/qtcoap/qcoapoption.html
/usr/share/doc/qt6/qtcoap/qcoapprivatekey-members.html
/usr/share/doc/qt6/qtcoap/qcoapprivatekey.html
/usr/share/doc/qt6/qtcoap/qcoapreply-members.html
/usr/share/doc/qt6/qtcoap/qcoapreply.html
/usr/share/doc/qt6/qtcoap/qcoaprequest-members.html
/usr/share/doc/qt6/qtcoap/qcoaprequest.html
/usr/share/doc/qt6/qtcoap/qcoapresource-members.html
/usr/share/doc/qt6/qtcoap/qcoapresource.html
/usr/share/doc/qt6/qtcoap/qcoapresourcediscoveryreply-members.html
/usr/share/doc/qt6/qtcoap/qcoapresourcediscoveryreply.html
/usr/share/doc/qt6/qtcoap/qcoapsecurityconfiguration-members.html
/usr/share/doc/qt6/qtcoap/qcoapsecurityconfiguration.html
/usr/share/doc/qt6/qtcoap/qtcoap-examples.html
/usr/share/doc/qt6/qtcoap/qtcoap-index.html
/usr/share/doc/qt6/qtcoap/qtcoap-module.html
/usr/share/doc/qt6/qtcoap/qtcoap-overview.html
/usr/share/doc/qt6/qtcoap/qtcoap-quickmulticastclient-cmakelists-txt.html
/usr/share/doc/qt6/qtcoap/qtcoap-quickmulticastclient-example.html
/usr/share/doc/qt6/qtcoap/qtcoap-quickmulticastclient-main-cpp.html
/usr/share/doc/qt6/qtcoap/qtcoap-quickmulticastclient-main-qml.html
/usr/share/doc/qt6/qtcoap/qtcoap-quickmulticastclient-qmlcoapmulticastclient-cpp.html
/usr/share/doc/qt6/qtcoap/qtcoap-quickmulticastclient-qmlcoapmulticastclient-h.html
/usr/share/doc/qt6/qtcoap/qtcoap-quickmulticastclient-qmldir.html
/usr/share/doc/qt6/qtcoap/qtcoap-quickmulticastclient-quickmulticastclient-pro.html
/usr/share/doc/qt6/qtcoap/qtcoap-quicksecureclient-cmakelists-txt.html
/usr/share/doc/qt6/qtcoap/qtcoap-quicksecureclient-example.html
/usr/share/doc/qt6/qtcoap/qtcoap-quicksecureclient-filepicker-qml.html
/usr/share/doc/qt6/qtcoap/qtcoap-quicksecureclient-main-cpp.html
/usr/share/doc/qt6/qtcoap/qtcoap-quicksecureclient-main-qml.html
/usr/share/doc/qt6/qtcoap/qtcoap-quicksecureclient-qmlcoapsecureclient-cpp.html
/usr/share/doc/qt6/qtcoap/qtcoap-quicksecureclient-qmlcoapsecureclient-h.html
/usr/share/doc/qt6/qtcoap/qtcoap-quicksecureclient-qmldir.html
/usr/share/doc/qt6/qtcoap/qtcoap-quicksecureclient-quicksecureclient-pro.html
/usr/share/doc/qt6/qtcoap/qtcoap-simplecoapclient-cmakelists-txt.html
/usr/share/doc/qt6/qtcoap/qtcoap-simplecoapclient-example.html
/usr/share/doc/qt6/qtcoap/qtcoap-simplecoapclient-main-cpp.html
/usr/share/doc/qt6/qtcoap/qtcoap-simplecoapclient-mainwindow-cpp.html
/usr/share/doc/qt6/qtcoap/qtcoap-simplecoapclient-mainwindow-h.html
/usr/share/doc/qt6/qtcoap/qtcoap-simplecoapclient-mainwindow-ui.html
/usr/share/doc/qt6/qtcoap/qtcoap-simplecoapclient-optiondialog-cpp.html
/usr/share/doc/qt6/qtcoap/qtcoap-simplecoapclient-optiondialog-h.html
/usr/share/doc/qt6/qtcoap/qtcoap-simplecoapclient-optiondialog-ui.html
/usr/share/doc/qt6/qtcoap/qtcoap-simplecoapclient-simplecoapclient-pro.html
/usr/share/doc/qt6/qtcoap/qtcoap.html
/usr/share/doc/qt6/qtcoap/qtcoap.index
/usr/share/doc/qt6/qtcoap/qtcoap.qhp
/usr/share/doc/qt6/qtcoap/qtcoap.qhp.sha1
/usr/share/doc/qt6/qtcoap/style
/usr/share/doc/qt6/qtcoap/style/offline-dark.css
/usr/share/doc/qt6/qtcoap/style/offline-simple.css
/usr/share/doc/qt6/qtcoap/style/offline.css
/usr/share/doc/qt6/qtconcurrent/concurrent-changes-qt6.html
/usr/share/doc/qt6/qtconcurrent/examples-manifest.xml
/usr/share/doc/qt6/qtconcurrent/images
/usr/share/doc/qt6/qtconcurrent/images/arrow_bc.png
/usr/share/doc/qt6/qtconcurrent/images/bgrContent.png
/usr/share/doc/qt6/qtconcurrent/images/btn_next.png
/usr/share/doc/qt6/qtconcurrent/images/btn_prev.png
/usr/share/doc/qt6/qtconcurrent/images/bullet_dn.png
/usr/share/doc/qt6/qtconcurrent/images/bullet_sq.png
/usr/share/doc/qt6/qtconcurrent/images/home.png
/usr/share/doc/qt6/qtconcurrent/images/ico_note.png
/usr/share/doc/qt6/qtconcurrent/images/ico_note_attention.png
/usr/share/doc/qt6/qtconcurrent/images/ico_out.png
/usr/share/doc/qt6/qtconcurrent/images/imagescaling.webp
/usr/share/doc/qt6/qtconcurrent/images/logo.png
/usr/share/doc/qt6/qtconcurrent/images/primecounter.png
/usr/share/doc/qt6/qtconcurrent/qtconcurrent-imagescaling-example.html
/usr/share/doc/qt6/qtconcurrent/qtconcurrent-index.html
/usr/share/doc/qt6/qtconcurrent/qtconcurrent-module.html
/usr/share/doc/qt6/qtconcurrent/qtconcurrent-primecounter-example.html
/usr/share/doc/qt6/qtconcurrent/qtconcurrent-qtaskbuilder-members.html
/usr/share/doc/qt6/qtconcurrent/qtconcurrent-qtaskbuilder.html
/usr/share/doc/qt6/qtconcurrent/qtconcurrent-wordcount-example.html
/usr/share/doc/qt6/qtconcurrent/qtconcurrent.html
/usr/share/doc/qt6/qtconcurrent/qtconcurrent.index
/usr/share/doc/qt6/qtconcurrent/qtconcurrent.qhp
/usr/share/doc/qt6/qtconcurrent/qtconcurrent.qhp.sha1
/usr/share/doc/qt6/qtconcurrent/qtconcurrentexamples.html
/usr/share/doc/qt6/qtconcurrent/qtconcurrentfilter.html
/usr/share/doc/qt6/qtconcurrent/qtconcurrentmap.html
/usr/share/doc/qt6/qtconcurrent/qtconcurrentrun.html
/usr/share/doc/qt6/qtconcurrent/qtconcurrenttask.html
/usr/share/doc/qt6/qtconcurrent/style
/usr/share/doc/qt6/qtconcurrent/style/offline-dark.css
/usr/share/doc/qt6/qtconcurrent/style/offline-simple.css
/usr/share/doc/qt6/qtconcurrent/style/offline.css
/usr/share/doc/qt6/qtcore/android-deploy-qt-tool.html
/usr/share/doc/qt6/qtcore/android-manifest-file-configuration.html
/usr/share/doc/qt6/qtcore/animation-overview.html
/usr/share/doc/qt6/qtcore/animation.html
/usr/share/doc/qt6/qtcore/bindableproperties.html
/usr/share/doc/qt6/qtcore/cbor.html
/usr/share/doc/qt6/qtcore/cmake-commands-qtcore.html
/usr/share/doc/qt6/qtcore/cmake-global-properties-qtcore.html
/usr/share/doc/qt6/qtcore/cmake-global-property-qt-targets-folder.html
/usr/share/doc/qt6/qtcore/cmake-source-file-properties-qtcore.html
/usr/share/doc/qt6/qtcore/cmake-source-file-property-qt-discard-file-contents.html
/usr/share/doc/qt6/qtcore/cmake-source-file-property-qt-resource-alias.html
/usr/share/doc/qt6/qtcore/cmake-target-properties-qtcore.html
/usr/share/doc/qt6/qtcore/cmake-target-property-qt-android-abis.html
/usr/share/doc/qt6/qtcore/cmake-target-property-qt-android-deployment-dependencies.html
/usr/share/doc/qt6/qtcore/cmake-target-property-qt-android-deployment-settings-file.html
/usr/share/doc/qt6/qtcore/cmake-target-property-qt-android-extra-libs.html
/usr/share/doc/qt6/qtcore/cmake-target-property-qt-android-extra-plugins.html
/usr/share/doc/qt6/qtcore/cmake-target-property-qt-android-min-sdk-version.html
/usr/share/doc/qt6/qtcore/cmake-target-property-qt-android-no-deploy-qt-libs.html
/usr/share/doc/qt6/qtcore/cmake-target-property-qt-android-package-source-dir.html
/usr/share/doc/qt6/qtcore/cmake-target-property-qt-android-sdk-build-tools-revision.html
/usr/share/doc/qt6/qtcore/cmake-target-property-qt-android-system-libs-prefix.html
/usr/share/doc/qt6/qtcore/cmake-target-property-qt-android-target-sdk-version.html
/usr/share/doc/qt6/qtcore/cmake-target-property-qt-android-version-code.html
/usr/share/doc/qt6/qtcore/cmake-target-property-qt-android-version-name.html
/usr/share/doc/qt6/qtcore/cmake-target-property-qt-ios-launch-screen.html
/usr/share/doc/qt6/qtcore/cmake-target-property-qt-no-entrypoint.html
/usr/share/doc/qt6/qtcore/cmake-target-property-qt-qml-import-path.html
/usr/share/doc/qt6/qtcore/cmake-target-property-qt-qml-root-path.html
/usr/share/doc/qt6/qtcore/cmake-target-property-qt-resource-prefix.html
/usr/share/doc/qt6/qtcore/cmake-target-property-qt-wasm-initial-memory.html
/usr/share/doc/qt6/qtcore/cmake-target-property-qt-wasm-pthread-pool-size.html
/usr/share/doc/qt6/qtcore/cmake-variable-android-ndk-host-system-name.html
/usr/share/doc/qt6/qtcore/cmake-variable-android-sdk-root.html
/usr/share/doc/qt6/qtcore/cmake-variable-qt-android-abis.html
/usr/share/doc/qt6/qtcore/cmake-variable-qt-android-application-arguments.html
/usr/share/doc/qt6/qtcore/cmake-variable-qt-android-build-all-abis.html
/usr/share/doc/qt6/qtcore/cmake-variable-qt-android-deploy-release.html
/usr/share/doc/qt6/qtcore/cmake-variable-qt-android-multi-abi-forward-vars.html
/usr/share/doc/qt6/qtcore/cmake-variable-qt-android-sign-aab.html
/usr/share/doc/qt6/qtcore/cmake-variable-qt-android-sign-apk.html
/usr/share/doc/qt6/qtcore/cmake-variable-qt-deploy-bin-dir.html
/usr/share/doc/qt6/qtcore/cmake-variable-qt-deploy-ignored-lib-dirs.html
/usr/share/doc/qt6/qtcore/cmake-variable-qt-deploy-lib-dir.html
/usr/share/doc/qt6/qtcore/cmake-variable-qt-deploy-plugins-dir.html
/usr/share/doc/qt6/qtcore/cmake-variable-qt-deploy-prefix.html
/usr/share/doc/qt6/qtcore/cmake-variable-qt-deploy-qml-dir.html
/usr/share/doc/qt6/qtcore/cmake-variable-qt-deploy-support.html
/usr/share/doc/qt6/qtcore/cmake-variable-qt-deploy-translations-dir.html
/usr/share/doc/qt6/qtcore/cmake-variable-qt-enable-verbose-deployment.html
/usr/share/doc/qt6/qtcore/cmake-variable-qt-host-path.html
/usr/share/doc/qt6/qtcore/cmake-variable-qt-ios-launch-screen.html
/usr/share/doc/qt6/qtcore/cmake-variable-qt-no-collect-build-tree-apk-deps.html
/usr/share/doc/qt6/qtcore/cmake-variable-qt-no-collect-imported-target-apk-deps.html
/usr/share/doc/qt6/qtcore/cmake-variable-qt-no-set-xcode-bundle-identifier.html
/usr/share/doc/qt6/qtcore/cmake-variable-qt-no-set-xcode-development-team-id.html
/usr/share/doc/qt6/qtcore/cmake-variable-qt-no-standard-project-setup.html
/usr/share/doc/qt6/qtcore/cmake-variable-qt-path-android-abi.html
/usr/share/doc/qt6/qtcore/cmake-variables-qtcore.html
/usr/share/doc/qt6/qtcore/containers.html
/usr/share/doc/qt6/qtcore/custom-types.html
/usr/share/doc/qt6/qtcore/datastreamformat.html
/usr/share/doc/qt6/qtcore/events.html
/usr/share/doc/qt6/qtcore/eventsandfilters.html
/usr/share/doc/qt6/qtcore/examples-manifest.xml
/usr/share/doc/qt6/qtcore/foreach-keyword.html
/usr/share/doc/qt6/qtcore/images
/usr/share/doc/qt6/qtcore/images/abstract-connections.png
/usr/share/doc/qt6/qtcore/images/androidnotifier.png
/usr/share/doc/qt6/qtcore/images/animations-architecture.png
/usr/share/doc/qt6/qtcore/images/arrow_bc.png
/usr/share/doc/qt6/qtcore/images/bgrContent.png
/usr/share/doc/qt6/qtcore/images/bindable_properties_example.png
/usr/share/doc/qt6/qtcore/images/brush-styles.png
/usr/share/doc/qt6/qtcore/images/btn_next.png
/usr/share/doc/qt6/qtcore/images/btn_prev.png
/usr/share/doc/qt6/qtcore/images/bullet_dn.png
/usr/share/doc/qt6/qtcore/images/bullet_sq.png
/usr/share/doc/qt6/qtcore/images/cbordump.png
/usr/share/doc/qt6/qtcore/images/convert.png
/usr/share/doc/qt6/qtcore/images/cursor-arrow.png
/usr/share/doc/qt6/qtcore/images/cursor-busy.png
/usr/share/doc/qt6/qtcore/images/cursor-closedhand.png
/usr/share/doc/qt6/qtcore/images/cursor-cross.png
/usr/share/doc/qt6/qtcore/images/cursor-forbidden.png
/usr/share/doc/qt6/qtcore/images/cursor-hand.png
/usr/share/doc/qt6/qtcore/images/cursor-hsplit.png
/usr/share/doc/qt6/qtcore/images/cursor-ibeam.png
/usr/share/doc/qt6/qtcore/images/cursor-openhand.png
/usr/share/doc/qt6/qtcore/images/cursor-sizeall.png
/usr/share/doc/qt6/qtcore/images/cursor-sizeb.png
/usr/share/doc/qt6/qtcore/images/cursor-sizef.png
/usr/share/doc/qt6/qtcore/images/cursor-sizeh.png
/usr/share/doc/qt6/qtcore/images/cursor-sizev.png
/usr/share/doc/qt6/qtcore/images/cursor-uparrow.png
/usr/share/doc/qt6/qtcore/images/cursor-vsplit.png
/usr/share/doc/qt6/qtcore/images/cursor-wait.png
/usr/share/doc/qt6/qtcore/images/cursor-whatsthis.png
/usr/share/doc/qt6/qtcore/images/filemenu.png
/usr/share/doc/qt6/qtcore/images/helpmenu.png
/usr/share/doc/qt6/qtcore/images/home.png
/usr/share/doc/qt6/qtcore/images/ico_note.png
/usr/share/doc/qt6/qtcore/images/ico_note_attention.png
/usr/share/doc/qt6/qtcore/images/ico_out.png
/usr/share/doc/qt6/qtcore/images/javaiterators1.png
/usr/share/doc/qt6/qtcore/images/javaiterators2.png
/usr/share/doc/qt6/qtcore/images/localfortuneclient-example.png
/usr/share/doc/qt6/qtcore/images/localfortuneserver-example.png
/usr/share/doc/qt6/qtcore/images/logo.png
/usr/share/doc/qt6/qtcore/images/mandelbrot-example.png
/usr/share/doc/qt6/qtcore/images/mandelbrot_scroll1.png
/usr/share/doc/qt6/qtcore/images/mandelbrot_scroll2.png
/usr/share/doc/qt6/qtcore/images/mandelbrot_scroll3.png
/usr/share/doc/qt6/qtcore/images/mandelbrot_zoom1.png
/usr/share/doc/qt6/qtcore/images/mandelbrot_zoom2.png
/usr/share/doc/qt6/qtcore/images/mandelbrot_zoom3.png
/usr/share/doc/qt6/qtcore/images/mimetypebrowser.png
/usr/share/doc/qt6/qtcore/images/modelindex-no-parent.png
/usr/share/doc/qt6/qtcore/images/modelview-begin-append-columns.png
/usr/share/doc/qt6/qtcore/images/modelview-begin-append-rows.png
/usr/share/doc/qt6/qtcore/images/modelview-begin-insert-columns.png
/usr/share/doc/qt6/qtcore/images/modelview-begin-insert-rows.png
/usr/share/doc/qt6/qtcore/images/modelview-begin-remove-columns.png
/usr/share/doc/qt6/qtcore/images/modelview-begin-remove-rows.png
/usr/share/doc/qt6/qtcore/images/modelview-move-rows-1.png
/usr/share/doc/qt6/qtcore/images/modelview-move-rows-2.png
/usr/share/doc/qt6/qtcore/images/modelview-move-rows-3.png
/usr/share/doc/qt6/qtcore/images/modelview-move-rows-4.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-inback.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-inbounce.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-incirc.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-incubic.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-inelastic.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-inexpo.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-inoutback.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-inoutbounce.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-inoutcirc.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-inoutcubic.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-inoutelastic.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-inoutexpo.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-inoutquad.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-inoutquart.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-inoutquint.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-inoutsine.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-inquad.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-inquart.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-inquint.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-insine.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-linear.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-outback.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-outbounce.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-outcirc.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-outcubic.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-outelastic.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-outexpo.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-outinback.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-outinbounce.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-outincirc.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-outincubic.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-outinelastic.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-outinexpo.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-outinquad.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-outinquart.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-outinquint.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-outinsine.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-outquad.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-outquart.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-outquint.png
/usr/share/doc/qt6/qtcore/images/qeasingcurve-outsine.png
/usr/share/doc/qt6/qtcore/images/qimage-scaling.png
/usr/share/doc/qt6/qtcore/images/qline-coordinates.png
/usr/share/doc/qt6/qtcore/images/qline-point.png
/usr/share/doc/qt6/qtcore/images/qlinef-bounded.png
/usr/share/doc/qt6/qtcore/images/qlinef-normalvector.png
/usr/share/doc/qt6/qtcore/images/qlinef-unbounded.png
/usr/share/doc/qt6/qtcore/images/qpen-bevel.png
/usr/share/doc/qt6/qtcore/images/qpen-custom.png
/usr/share/doc/qt6/qtcore/images/qpen-dash.png
/usr/share/doc/qt6/qtcore/images/qpen-dashdot.png
/usr/share/doc/qt6/qtcore/images/qpen-dashdotdot.png
/usr/share/doc/qt6/qtcore/images/qpen-dot.png
/usr/share/doc/qt6/qtcore/images/qpen-flat.png
/usr/share/doc/qt6/qtcore/images/qpen-miter.png
/usr/share/doc/qt6/qtcore/images/qpen-roundcap.png
/usr/share/doc/qt6/qtcore/images/qpen-roundjoin.png
/usr/share/doc/qt6/qtcore/images/qpen-solid.png
/usr/share/doc/qt6/qtcore/images/qpen-square.png
/usr/share/doc/qt6/qtcore/images/qrect-coordinates.png
/usr/share/doc/qt6/qtcore/images/qrect-diagram-one.png
/usr/share/doc/qt6/qtcore/images/qrect-diagram-three.png
/usr/share/doc/qt6/qtcore/images/qrect-diagram-two.png
/usr/share/doc/qt6/qtcore/images/qrect-diagram-zero.png
/usr/share/doc/qt6/qtcore/images/qrect-intersect.png
/usr/share/doc/qt6/qtcore/images/qrect-unite.png
/usr/share/doc/qt6/qtcore/images/qrectf-coordinates.png
/usr/share/doc/qt6/qtcore/images/qrectf-diagram-one.png
/usr/share/doc/qt6/qtcore/images/qrectf-diagram-three.png
/usr/share/doc/qt6/qtcore/images/qrectf-diagram-two.png
/usr/share/doc/qt6/qtcore/images/qsortfilterproxymodel-sorting.png
/usr/share/doc/qt6/qtcore/images/queuedcustomtype-example.png
/usr/share/doc/qt6/qtcore/images/qurl-authority.png
/usr/share/doc/qt6/qtcore/images/qurl-authority2.png
/usr/share/doc/qt6/qtcore/images/qurl-authority3.png
/usr/share/doc/qt6/qtcore/images/qurl-fragment.png
/usr/share/doc/qt6/qtcore/images/qurl-ftppath.png
/usr/share/doc/qt6/qtcore/images/qurl-mailtopath.png
/usr/share/doc/qt6/qtcore/images/qurl-querystring.png
/usr/share/doc/qt6/qtcore/images/screenshot.png
/usr/share/doc/qt6/qtcore/images/sharedmemory-example_1.png
/usr/share/doc/qt6/qtcore/images/sharedmemory-example_2.png
/usr/share/doc/qt6/qtcore/images/stliterators1.png
/usr/share/doc/qt6/qtcore/implicit-sharing.html
/usr/share/doc/qt6/qtcore/io-functions.html
/usr/share/doc/qt6/qtcore/io.html
/usr/share/doc/qt6/qtcore/ipc.html
/usr/share/doc/qt6/qtcore/java-style-iterators.html
/usr/share/doc/qt6/qtcore/json.html
/usr/share/doc/qt6/qtcore/metaobjects.html
/usr/share/doc/qt6/qtcore/native-ipc-keys.html
/usr/share/doc/qt6/qtcore/object.html
/usr/share/doc/qt6/qtcore/objecttrees.html
/usr/share/doc/qt6/qtcore/permissions.html
/usr/share/doc/qt6/qtcore/plugins.html
/usr/share/doc/qt6/qtcore/properties.html
/usr/share/doc/qt6/qtcore/qabstractanimation-members.html
/usr/share/doc/qt6/qtcore/qabstractanimation.html
/usr/share/doc/qt6/qtcore/qabstracteventdispatcher-members.html
/usr/share/doc/qt6/qtcore/qabstracteventdispatcher-timerinfo-members.html
/usr/share/doc/qt6/qtcore/qabstracteventdispatcher-timerinfo.html
/usr/share/doc/qt6/qtcore/qabstracteventdispatcher.html
/usr/share/doc/qt6/qtcore/qabstractitemmodel-members.html
/usr/share/doc/qt6/qtcore/qabstractitemmodel.html
/usr/share/doc/qt6/qtcore/qabstractlistmodel-members.html
/usr/share/doc/qt6/qtcore/qabstractlistmodel.html
/usr/share/doc/qt6/qtcore/qabstractnativeeventfilter-members.html
/usr/share/doc/qt6/qtcore/qabstractnativeeventfilter.html
/usr/share/doc/qt6/qtcore/qabstractproxymodel-members.html
/usr/share/doc/qt6/qtcore/qabstractproxymodel.html
/usr/share/doc/qt6/qtcore/qabstracttablemodel-members.html
/usr/share/doc/qt6/qtcore/qabstracttablemodel.html
/usr/share/doc/qt6/qtcore/qadoptshareddatatag.html
/usr/share/doc/qt6/qtcore/qandroidactivityresultreceiver-members.html
/usr/share/doc/qt6/qtcore/qandroidactivityresultreceiver.html
/usr/share/doc/qt6/qtcore/qandroidbinder-members.html
/usr/share/doc/qt6/qtcore/qandroidbinder.html
/usr/share/doc/qt6/qtcore/qandroidintent-members.html
/usr/share/doc/qt6/qtcore/qandroidintent.html
/usr/share/doc/qt6/qtcore/qandroidparcel-members.html
/usr/share/doc/qt6/qtcore/qandroidparcel.html
/usr/share/doc/qt6/qtcore/qandroidservice-members.html
/usr/share/doc/qt6/qtcore/qandroidservice.html
/usr/share/doc/qt6/qtcore/qandroidserviceconnection-members.html
/usr/share/doc/qt6/qtcore/qandroidserviceconnection.html
/usr/share/doc/qt6/qtcore/qanimationgroup-members.html
/usr/share/doc/qt6/qtcore/qanimationgroup.html
/usr/share/doc/qt6/qtcore/qanystringview-members.html
/usr/share/doc/qt6/qtcore/qanystringview-obsolete.html
/usr/share/doc/qt6/qtcore/qanystringview.html
/usr/share/doc/qt6/qtcore/qassociativeiterable-members.html
/usr/share/doc/qt6/qtcore/qassociativeiterable.html
/usr/share/doc/qt6/qtcore/qatomicint-members.html
/usr/share/doc/qt6/qtcore/qatomicint.html
/usr/share/doc/qt6/qtcore/qatomicinteger-members.html
/usr/share/doc/qt6/qtcore/qatomicinteger.html
/usr/share/doc/qt6/qtcore/qatomicpointer-members.html
/usr/share/doc/qt6/qtcore/qatomicpointer.html
/usr/share/doc/qt6/qtcore/qbaseiterator-members.html
/usr/share/doc/qt6/qtcore/qbaseiterator.html
/usr/share/doc/qt6/qtcore/qbasictimer-members.html
/usr/share/doc/qt6/qtcore/qbasictimer-obsolete.html
/usr/share/doc/qt6/qtcore/qbasictimer.html
/usr/share/doc/qt6/qtcore/qbeinteger-members.html
/usr/share/doc/qt6/qtcore/qbeinteger.html
/usr/share/doc/qt6/qtcore/qbindable-members.html
/usr/share/doc/qt6/qtcore/qbindable.html
/usr/share/doc/qt6/qtcore/qbitarray-members.html
/usr/share/doc/qt6/qtcore/qbitarray.html
/usr/share/doc/qt6/qtcore/qbluetoothpermission-members.html
/usr/share/doc/qt6/qtcore/qbluetoothpermission.html
/usr/share/doc/qt6/qtcore/qbuffer-members.html
/usr/share/doc/qt6/qtcore/qbuffer.html
/usr/share/doc/qt6/qtcore/qbytearray-frombase64result-members.html
/usr/share/doc/qt6/qtcore/qbytearray-frombase64result.html
/usr/share/doc/qt6/qtcore/qbytearray-members.html
/usr/share/doc/qt6/qtcore/qbytearray-obsolete.html
/usr/share/doc/qt6/qtcore/qbytearray.html
/usr/share/doc/qt6/qtcore/qbytearraylist-members.html
/usr/share/doc/qt6/qtcore/qbytearraylist.html
/usr/share/doc/qt6/qtcore/qbytearraymatcher-members.html
/usr/share/doc/qt6/qtcore/qbytearraymatcher.html
/usr/share/doc/qt6/qtcore/qbytearrayview-members.html
/usr/share/doc/qt6/qtcore/qbytearrayview-obsolete.html
/usr/share/doc/qt6/qtcore/qbytearrayview.html
/usr/share/doc/qt6/qtcore/qcache-members.html
/usr/share/doc/qt6/qtcore/qcache.html
/usr/share/doc/qt6/qtcore/qcalendar-members.html
/usr/share/doc/qt6/qtcore/qcalendar-systemid-members.html
/usr/share/doc/qt6/qtcore/qcalendar-systemid.html
/usr/share/doc/qt6/qtcore/qcalendar.html
/usr/share/doc/qt6/qtcore/qcalendarpermission-members.html
/usr/share/doc/qt6/qtcore/qcalendarpermission.html
/usr/share/doc/qt6/qtcore/qcamerapermission.html
/usr/share/doc/qt6/qtcore/qcborarray-constiterator-members.html
/usr/share/doc/qt6/qtcore/qcborarray-constiterator.html
/usr/share/doc/qt6/qtcore/qcborarray-iterator-members.html
/usr/share/doc/qt6/qtcore/qcborarray-iterator.html
/usr/share/doc/qt6/qtcore/qcborarray-members.html
/usr/share/doc/qt6/qtcore/qcborarray.html
/usr/share/doc/qt6/qtcore/qcborerror-members.html
/usr/share/doc/qt6/qtcore/qcborerror.html
/usr/share/doc/qt6/qtcore/qcbormap-constiterator-members.html
/usr/share/doc/qt6/qtcore/qcbormap-constiterator.html
/usr/share/doc/qt6/qtcore/qcbormap-iterator-members.html
/usr/share/doc/qt6/qtcore/qcbormap-iterator.html
/usr/share/doc/qt6/qtcore/qcbormap-members.html
/usr/share/doc/qt6/qtcore/qcbormap.html
/usr/share/doc/qt6/qtcore/qcborparsererror-members.html
/usr/share/doc/qt6/qtcore/qcborparsererror.html
/usr/share/doc/qt6/qtcore/qcborstreamreader-members.html
/usr/share/doc/qt6/qtcore/qcborstreamreader-stringresult-members.html
/usr/share/doc/qt6/qtcore/qcborstreamreader-stringresult.html
/usr/share/doc/qt6/qtcore/qcborstreamreader.html
/usr/share/doc/qt6/qtcore/qcborstreamwriter-members.html
/usr/share/doc/qt6/qtcore/qcborstreamwriter.html
/usr/share/doc/qt6/qtcore/qcborvalue-members.html
/usr/share/doc/qt6/qtcore/qcborvalue.html
/usr/share/doc/qt6/qtcore/qchar-members.html
/usr/share/doc/qt6/qtcore/qchar.html
/usr/share/doc/qt6/qtcore/qchildevent-members.html
/usr/share/doc/qt6/qtcore/qchildevent.html
/usr/share/doc/qt6/qtcore/qcollator-members.html
/usr/share/doc/qt6/qtcore/qcollator.html
/usr/share/doc/qt6/qtcore/qcollatorsortkey-members.html
/usr/share/doc/qt6/qtcore/qcollatorsortkey.html
/usr/share/doc/qt6/qtcore/qcommandlineoption-members.html
/usr/share/doc/qt6/qtcore/qcommandlineoption.html
/usr/share/doc/qt6/qtcore/qcommandlineparser-members.html
/usr/share/doc/qt6/qtcore/qcommandlineparser.html
/usr/share/doc/qt6/qtcore/qconcatenatetablesproxymodel-members.html
/usr/share/doc/qt6/qtcore/qconcatenatetablesproxymodel.html
/usr/share/doc/qt6/qtcore/qconstiterator-members.html
/usr/share/doc/qt6/qtcore/qconstiterator.html
/usr/share/doc/qt6/qtcore/qcontactspermission-members.html
/usr/share/doc/qt6/qtcore/qcontactspermission.html
/usr/share/doc/qt6/qtcore/qcontiguouscache-members.html
/usr/share/doc/qt6/qtcore/qcontiguouscache.html
/usr/share/doc/qt6/qtcore/qcoreapplication-members.html
/usr/share/doc/qt6/qtcore/qcoreapplication.html
/usr/share/doc/qt6/qtcore/qcryptographichash-members.html
/usr/share/doc/qt6/qtcore/qcryptographichash-obsolete.html
/usr/share/doc/qt6/qtcore/qcryptographichash.html
/usr/share/doc/qt6/qtcore/qdatastream-members.html
/usr/share/doc/qt6/qtcore/qdatastream.html
/usr/share/doc/qt6/qtcore/qdate-members.html
/usr/share/doc/qt6/qtcore/qdate-obsolete.html
/usr/share/doc/qt6/qtcore/qdate.html
/usr/share/doc/qt6/qtcore/qdatetime-members.html
/usr/share/doc/qt6/qtcore/qdatetime-obsolete.html
/usr/share/doc/qt6/qtcore/qdatetime.html
/usr/share/doc/qt6/qtcore/qdeadlinetimer-members.html
/usr/share/doc/qt6/qtcore/qdeadlinetimer.html
/usr/share/doc/qt6/qtcore/qdebug-members.html
/usr/share/doc/qt6/qtcore/qdebug.html
/usr/share/doc/qt6/qtcore/qdebugstatesaver-members.html
/usr/share/doc/qt6/qtcore/qdebugstatesaver.html
/usr/share/doc/qt6/qtcore/qdir-members.html
/usr/share/doc/qt6/qtcore/qdir.html
/usr/share/doc/qt6/qtcore/qdiriterator-members.html
/usr/share/doc/qt6/qtcore/qdiriterator.html
/usr/share/doc/qt6/qtcore/qdynamicpropertychangeevent-members.html
/usr/share/doc/qt6/qtcore/qdynamicpropertychangeevent.html
/usr/share/doc/qt6/qtcore/qeasingcurve-members.html
/usr/share/doc/qt6/qtcore/qeasingcurve.html
/usr/share/doc/qt6/qtcore/qelapsedtimer-members.html
/usr/share/doc/qt6/qtcore/qelapsedtimer.html
/usr/share/doc/qt6/qtcore/qenablesharedfromthis-members.html
/usr/share/doc/qt6/qtcore/qenablesharedfromthis.html
/usr/share/doc/qt6/qtcore/qevent-members.html
/usr/share/doc/qt6/qtcore/qevent.html
/usr/share/doc/qt6/qtcore/qeventloop-members.html
/usr/share/doc/qt6/qtcore/qeventloop.html
/usr/share/doc/qt6/qtcore/qeventlooplocker-members.html
/usr/share/doc/qt6/qtcore/qeventlooplocker.html
/usr/share/doc/qt6/qtcore/qexception-members.html
/usr/share/doc/qt6/qtcore/qexception.html
/usr/share/doc/qt6/qtcore/qexplicitlyshareddatapointer-members.html
/usr/share/doc/qt6/qtcore/qexplicitlyshareddatapointer.html
/usr/share/doc/qt6/qtcore/qfile-members.html
/usr/share/doc/qt6/qtcore/qfile.html
/usr/share/doc/qt6/qtcore/qfiledevice-members.html
/usr/share/doc/qt6/qtcore/qfiledevice.html
/usr/share/doc/qt6/qtcore/qfileinfo-members.html
/usr/share/doc/qt6/qtcore/qfileinfo.html
/usr/share/doc/qt6/qtcore/qfileselector-members.html
/usr/share/doc/qt6/qtcore/qfileselector.html
/usr/share/doc/qt6/qtcore/qfilesystemwatcher-members.html
/usr/share/doc/qt6/qtcore/qfilesystemwatcher.html
/usr/share/doc/qt6/qtcore/qflag-members.html
/usr/share/doc/qt6/qtcore/qflag.html
/usr/share/doc/qt6/qtcore/qflags-members.html
/usr/share/doc/qt6/qtcore/qflags.html
/usr/share/doc/qt6/qtcore/qfloat16-members.html
/usr/share/doc/qt6/qtcore/qfloat16.html
/usr/share/doc/qt6/qtcore/qforeach-qtcore-proxy.html
/usr/share/doc/qt6/qtcore/qfunctionpointer-qtcore-proxy.html
/usr/share/doc/qt6/qtcore/qfuture-const-iterator-members.html
/usr/share/doc/qt6/qtcore/qfuture-const-iterator.html
/usr/share/doc/qt6/qtcore/qfuture-members.html
/usr/share/doc/qt6/qtcore/qfuture-obsolete.html
/usr/share/doc/qt6/qtcore/qfuture.html
/usr/share/doc/qt6/qtcore/qfutureiterator-members.html
/usr/share/doc/qt6/qtcore/qfutureiterator.html
/usr/share/doc/qt6/qtcore/qfuturesynchronizer-members.html
/usr/share/doc/qt6/qtcore/qfuturesynchronizer.html
/usr/share/doc/qt6/qtcore/qfuturewatcher-members.html
/usr/share/doc/qt6/qtcore/qfuturewatcher-obsolete.html
/usr/share/doc/qt6/qtcore/qfuturewatcher.html
/usr/share/doc/qt6/qtcore/qgenericargument-members.html
/usr/share/doc/qt6/qtcore/qgenericargument.html
/usr/share/doc/qt6/qtcore/qgenericreturnargument-members.html
/usr/share/doc/qt6/qtcore/qgenericreturnargument.html
/usr/share/doc/qt6/qtcore/qglobalstatic-members.html
/usr/share/doc/qt6/qtcore/qglobalstatic-obsolete.html
/usr/share/doc/qt6/qtcore/qglobalstatic.html
/usr/share/doc/qt6/qtcore/qgregoriancalendar.html
/usr/share/doc/qt6/qtcore/qhash-const-iterator-members.html
/usr/share/doc/qt6/qtcore/qhash-const-iterator.html
/usr/share/doc/qt6/qtcore/qhash-iterator-members.html
/usr/share/doc/qt6/qtcore/qhash-iterator.html
/usr/share/doc/qt6/qtcore/qhash-key-iterator-members.html
/usr/share/doc/qt6/qtcore/qhash-key-iterator.html
/usr/share/doc/qt6/qtcore/qhash-members.html
/usr/share/doc/qt6/qtcore/qhash-obsolete.html
/usr/share/doc/qt6/qtcore/qhash.html
/usr/share/doc/qt6/qtcore/qhashiterator-members.html
/usr/share/doc/qt6/qtcore/qhashiterator.html
/usr/share/doc/qt6/qtcore/qhashseed-members.html
/usr/share/doc/qt6/qtcore/qhashseed.html
/usr/share/doc/qt6/qtcore/qidentityproxymodel-members.html
/usr/share/doc/qt6/qtcore/qidentityproxymodel.html
/usr/share/doc/qt6/qtcore/qiodevice-members.html
/usr/share/doc/qt6/qtcore/qiodevice.html
/usr/share/doc/qt6/qtcore/qiodevicebase-members.html
/usr/share/doc/qt6/qtcore/qiodevicebase.html
/usr/share/doc/qt6/qtcore/qitemselection-members.html
/usr/share/doc/qt6/qtcore/qitemselection.html
/usr/share/doc/qt6/qtcore/qitemselectionmodel-members.html
/usr/share/doc/qt6/qtcore/qitemselectionmodel.html
/usr/share/doc/qt6/qtcore/qitemselectionrange-members.html
/usr/share/doc/qt6/qtcore/qitemselectionrange.html
/usr/share/doc/qt6/qtcore/qiterable-members.html
/usr/share/doc/qt6/qtcore/qiterable.html
/usr/share/doc/qt6/qtcore/qiterator-members.html
/usr/share/doc/qt6/qtcore/qiterator.html
/usr/share/doc/qt6/qtcore/qjalalicalendar.html
/usr/share/doc/qt6/qtcore/qjnienvironment-members.html
/usr/share/doc/qt6/qtcore/qjnienvironment-obsolete.html
/usr/share/doc/qt6/qtcore/qjnienvironment.html
/usr/share/doc/qt6/qtcore/qjniobject-members.html
/usr/share/doc/qt6/qtcore/qjniobject.html
/usr/share/doc/qt6/qtcore/qjsonarray-const-iterator-members.html
/usr/share/doc/qt6/qtcore/qjsonarray-const-iterator.html
/usr/share/doc/qt6/qtcore/qjsonarray-iterator-members.html
/usr/share/doc/qt6/qtcore/qjsonarray-iterator.html
/usr/share/doc/qt6/qtcore/qjsonarray-members.html
/usr/share/doc/qt6/qtcore/qjsonarray.html
/usr/share/doc/qt6/qtcore/qjsondocument-members.html
/usr/share/doc/qt6/qtcore/qjsondocument.html
/usr/share/doc/qt6/qtcore/qjsonobject-const-iterator-members.html
/usr/share/doc/qt6/qtcore/qjsonobject-const-iterator.html
/usr/share/doc/qt6/qtcore/qjsonobject-iterator-members.html
/usr/share/doc/qt6/qtcore/qjsonobject-iterator.html
/usr/share/doc/qt6/qtcore/qjsonobject-members.html
/usr/share/doc/qt6/qtcore/qjsonobject.html
/usr/share/doc/qt6/qtcore/qjsonparseerror-members.html
/usr/share/doc/qt6/qtcore/qjsonparseerror.html
/usr/share/doc/qt6/qtcore/qjsonvalue-members.html
/usr/share/doc/qt6/qtcore/qjsonvalue.html
/usr/share/doc/qt6/qtcore/qjuliancalendar.html
/usr/share/doc/qt6/qtcore/qkeycombination-members.html
/usr/share/doc/qt6/qtcore/qkeycombination-obsolete.html
/usr/share/doc/qt6/qtcore/qkeycombination.html
/usr/share/doc/qt6/qtcore/qkeyvalueiterator-members.html
/usr/share/doc/qt6/qtcore/qkeyvalueiterator.html
/usr/share/doc/qt6/qtcore/qlatin1char-members.html
/usr/share/doc/qt6/qtcore/qlatin1char.html
/usr/share/doc/qt6/qtcore/qlatin1string.html
/usr/share/doc/qt6/qtcore/qlatin1stringmatcher-members.html
/usr/share/doc/qt6/qtcore/qlatin1stringmatcher.html
/usr/share/doc/qt6/qtcore/qlatin1stringview-members.html
/usr/share/doc/qt6/qtcore/qlatin1stringview.html
/usr/share/doc/qt6/qtcore/qleinteger-members.html
/usr/share/doc/qt6/qtcore/qleinteger.html
/usr/share/doc/qt6/qtcore/qlibrary-members.html
/usr/share/doc/qt6/qtcore/qlibrary.html
/usr/share/doc/qt6/qtcore/qlibraryinfo-members.html
/usr/share/doc/qt6/qtcore/qlibraryinfo-obsolete.html
/usr/share/doc/qt6/qtcore/qlibraryinfo.html
/usr/share/doc/qt6/qtcore/qline-members.html
/usr/share/doc/qt6/qtcore/qline.html
/usr/share/doc/qt6/qtcore/qlinef-members.html
/usr/share/doc/qt6/qtcore/qlinef-obsolete.html
/usr/share/doc/qt6/qtcore/qlinef.html
/usr/share/doc/qt6/qtcore/qlist-const-iterator.html
/usr/share/doc/qt6/qtcore/qlist-iterator.html
/usr/share/doc/qt6/qtcore/qlist-members.html
/usr/share/doc/qt6/qtcore/qlist-obsolete.html
/usr/share/doc/qt6/qtcore/qlist.html
/usr/share/doc/qt6/qtcore/qlistiterator-members.html
/usr/share/doc/qt6/qtcore/qlistiterator.html
/usr/share/doc/qt6/qtcore/qlocale-members.html
/usr/share/doc/qt6/qtcore/qlocale-obsolete.html
/usr/share/doc/qt6/qtcore/qlocale.html
/usr/share/doc/qt6/qtcore/qlocationpermission-members.html
/usr/share/doc/qt6/qtcore/qlocationpermission.html
/usr/share/doc/qt6/qtcore/qlockfile-members.html
/usr/share/doc/qt6/qtcore/qlockfile.html
/usr/share/doc/qt6/qtcore/qloggingcategory-members.html
/usr/share/doc/qt6/qtcore/qloggingcategory.html
/usr/share/doc/qt6/qtcore/qmap-const-iterator-members.html
/usr/share/doc/qt6/qtcore/qmap-const-iterator-obsolete.html
/usr/share/doc/qt6/qtcore/qmap-const-iterator.html
/usr/share/doc/qt6/qtcore/qmap-iterator-members.html
/usr/share/doc/qt6/qtcore/qmap-iterator-obsolete.html
/usr/share/doc/qt6/qtcore/qmap-iterator.html
/usr/share/doc/qt6/qtcore/qmap-key-iterator-members.html
/usr/share/doc/qt6/qtcore/qmap-key-iterator.html
/usr/share/doc/qt6/qtcore/qmap-members.html
/usr/share/doc/qt6/qtcore/qmap.html
/usr/share/doc/qt6/qtcore/qmapiterator-members.html
/usr/share/doc/qt6/qtcore/qmapiterator.html
/usr/share/doc/qt6/qtcore/qmargins-members.html
/usr/share/doc/qt6/qtcore/qmargins.html
/usr/share/doc/qt6/qtcore/qmarginsf-members.html
/usr/share/doc/qt6/qtcore/qmarginsf.html
/usr/share/doc/qt6/qtcore/qmessageauthenticationcode-members.html
/usr/share/doc/qt6/qtcore/qmessageauthenticationcode.html
/usr/share/doc/qt6/qtcore/qmessagelogcontext.html
/usr/share/doc/qt6/qtcore/qmessagelogger-members.html
/usr/share/doc/qt6/qtcore/qmessagelogger.html
/usr/share/doc/qt6/qtcore/qmetaclassinfo-members.html
/usr/share/doc/qt6/qtcore/qmetaclassinfo.html
/usr/share/doc/qt6/qtcore/qmetaenum-members.html
/usr/share/doc/qt6/qtcore/qmetaenum.html
/usr/share/doc/qt6/qtcore/qmetamethod-members.html
/usr/share/doc/qt6/qtcore/qmetamethod-obsolete.html
/usr/share/doc/qt6/qtcore/qmetamethod.html
/usr/share/doc/qt6/qtcore/qmetaobject-connection-members.html
/usr/share/doc/qt6/qtcore/qmetaobject-connection.html
/usr/share/doc/qt6/qtcore/qmetaobject-members.html
/usr/share/doc/qt6/qtcore/qmetaobject-obsolete.html
/usr/share/doc/qt6/qtcore/qmetaobject.html
/usr/share/doc/qt6/qtcore/qmetaproperty-members.html
/usr/share/doc/qt6/qtcore/qmetaproperty-obsolete.html
/usr/share/doc/qt6/qtcore/qmetaproperty.html
/usr/share/doc/qt6/qtcore/qmetasequence-members.html
/usr/share/doc/qt6/qtcore/qmetasequence.html
/usr/share/doc/qt6/qtcore/qmetatype-members.html
/usr/share/doc/qt6/qtcore/qmetatype-obsolete.html
/usr/share/doc/qt6/qtcore/qmetatype.html
/usr/share/doc/qt6/qtcore/qmicrophonepermission.html
/usr/share/doc/qt6/qtcore/qmilankoviccalendar.html
/usr/share/doc/qt6/qtcore/qmimedata-members.html
/usr/share/doc/qt6/qtcore/qmimedata.html
/usr/share/doc/qt6/qtcore/qmimedatabase-members.html
/usr/share/doc/qt6/qtcore/qmimedatabase.html
/usr/share/doc/qt6/qtcore/qmimetype-members.html
/usr/share/doc/qt6/qtcore/qmimetype.html
/usr/share/doc/qt6/qtcore/qmodelindex-members.html
/usr/share/doc/qt6/qtcore/qmodelindex.html
/usr/share/doc/qt6/qtcore/qmodelroledata-members.html
/usr/share/doc/qt6/qtcore/qmodelroledata.html
/usr/share/doc/qt6/qtcore/qmodelroledataspan-members.html
/usr/share/doc/qt6/qtcore/qmodelroledataspan.html
/usr/share/doc/qt6/qtcore/qmultihash-const-iterator-members.html
/usr/share/doc/qt6/qtcore/qmultihash-const-iterator.html
/usr/share/doc/qt6/qtcore/qmultihash-iterator-members.html
/usr/share/doc/qt6/qtcore/qmultihash-iterator.html
/usr/share/doc/qt6/qtcore/qmultihash-key-iterator-members.html
/usr/share/doc/qt6/qtcore/qmultihash-key-iterator.html
/usr/share/doc/qt6/qtcore/qmultihash-members.html
/usr/share/doc/qt6/qtcore/qmultihash.html
/usr/share/doc/qt6/qtcore/qmultimap-const-iterator-members.html
/usr/share/doc/qt6/qtcore/qmultimap-const-iterator-obsolete.html
/usr/share/doc/qt6/qtcore/qmultimap-const-iterator.html
/usr/share/doc/qt6/qtcore/qmultimap-iterator-members.html
/usr/share/doc/qt6/qtcore/qmultimap-iterator-obsolete.html
/usr/share/doc/qt6/qtcore/qmultimap-iterator.html
/usr/share/doc/qt6/qtcore/qmultimap-key-iterator-members.html
/usr/share/doc/qt6/qtcore/qmultimap-key-iterator.html
/usr/share/doc/qt6/qtcore/qmultimap-members.html
/usr/share/doc/qt6/qtcore/qmultimap-obsolete.html
/usr/share/doc/qt6/qtcore/qmultimap.html
/usr/share/doc/qt6/qtcore/qmultimapiterator-members.html
/usr/share/doc/qt6/qtcore/qmultimapiterator.html
/usr/share/doc/qt6/qtcore/qmutablehashiterator-members.html
/usr/share/doc/qt6/qtcore/qmutablehashiterator.html
/usr/share/doc/qt6/qtcore/qmutablelistiterator-members.html
/usr/share/doc/qt6/qtcore/qmutablelistiterator.html
/usr/share/doc/qt6/qtcore/qmutablemapiterator-members.html
/usr/share/doc/qt6/qtcore/qmutablemapiterator.html
/usr/share/doc/qt6/qtcore/qmutablemultimapiterator-members.html
/usr/share/doc/qt6/qtcore/qmutablemultimapiterator.html
/usr/share/doc/qt6/qtcore/qmutablesetiterator-members.html
/usr/share/doc/qt6/qtcore/qmutablesetiterator.html
/usr/share/doc/qt6/qtcore/qmutex-members.html
/usr/share/doc/qt6/qtcore/qmutex.html
/usr/share/doc/qt6/qtcore/qmutexlocker-members.html
/usr/share/doc/qt6/qtcore/qmutexlocker.html
/usr/share/doc/qt6/qtcore/qnativeinterface-qandroidapplication-members.html
/usr/share/doc/qt6/qtcore/qnativeinterface-qandroidapplication.html
/usr/share/doc/qt6/qtcore/qnativeinterface-sub-qtcore.html
/usr/share/doc/qt6/qtcore/qnativeipckey-members.html
/usr/share/doc/qt6/qtcore/qnativeipckey.html
/usr/share/doc/qt6/qtcore/qntfspermissioncheckguard-members.html
/usr/share/doc/qt6/qtcore/qntfspermissioncheckguard.html
/usr/share/doc/qt6/qtcore/qobject-members.html
/usr/share/doc/qt6/qtcore/qobject-obsolete.html
/usr/share/doc/qt6/qtcore/qobject.html
/usr/share/doc/qt6/qtcore/qobjectbindableproperty-members.html
/usr/share/doc/qt6/qtcore/qobjectbindableproperty.html
/usr/share/doc/qt6/qtcore/qobjectcleanuphandler-members.html
/usr/share/doc/qt6/qtcore/qobjectcleanuphandler.html
/usr/share/doc/qt6/qtcore/qobjectcomputedproperty.html
/usr/share/doc/qt6/qtcore/qoperatingsystemversion-members.html
/usr/share/doc/qt6/qtcore/qoperatingsystemversion.html
/usr/share/doc/qt6/qtcore/qoverload-qtcore-proxy.html
/usr/share/doc/qt6/qtcore/qpair-qtcore-proxy.html
/usr/share/doc/qt6/qtcore/qparallelanimationgroup-members.html
/usr/share/doc/qt6/qtcore/qparallelanimationgroup.html
/usr/share/doc/qt6/qtcore/qpartialordering-members.html
/usr/share/doc/qt6/qtcore/qpartialordering.html
/usr/share/doc/qt6/qtcore/qpauseanimation-members.html
/usr/share/doc/qt6/qtcore/qpauseanimation.html
/usr/share/doc/qt6/qtcore/qpermission-members.html
/usr/share/doc/qt6/qtcore/qpermission.html
/usr/share/doc/qt6/qtcore/qpersistentmodelindex-members.html
/usr/share/doc/qt6/qtcore/qpersistentmodelindex.html
/usr/share/doc/qt6/qtcore/qpluginloader-members.html
/usr/share/doc/qt6/qtcore/qpluginloader.html
/usr/share/doc/qt6/qtcore/qpoint-members.html
/usr/share/doc/qt6/qtcore/qpoint.html
/usr/share/doc/qt6/qtcore/qpointer-members.html
/usr/share/doc/qt6/qtcore/qpointer.html
/usr/share/doc/qt6/qtcore/qpointf-members.html
/usr/share/doc/qt6/qtcore/qpointf.html
/usr/share/doc/qt6/qtcore/qprocess-createprocessarguments.html
/usr/share/doc/qt6/qtcore/qprocess-members.html
/usr/share/doc/qt6/qtcore/qprocess-obsolete.html
/usr/share/doc/qt6/qtcore/qprocess-unixprocessparameters.html
/usr/share/doc/qt6/qtcore/qprocess.html
/usr/share/doc/qt6/qtcore/qprocessenvironment-members.html
/usr/share/doc/qt6/qtcore/qprocessenvironment.html
/usr/share/doc/qt6/qtcore/qpromise-members.html
/usr/share/doc/qt6/qtcore/qpromise.html
/usr/share/doc/qt6/qtcore/qproperty-members.html
/usr/share/doc/qt6/qtcore/qproperty.html
/usr/share/doc/qt6/qtcore/qpropertyanimation-members.html
/usr/share/doc/qt6/qtcore/qpropertyanimation.html
/usr/share/doc/qt6/qtcore/qpropertybindingerror-members.html
/usr/share/doc/qt6/qtcore/qpropertybindingerror.html
/usr/share/doc/qt6/qtcore/qpropertychangehandler.html
/usr/share/doc/qt6/qtcore/qpropertydata-members.html
/usr/share/doc/qt6/qtcore/qpropertydata.html
/usr/share/doc/qt6/qtcore/qpropertynotifier.html
/usr/share/doc/qt6/qtcore/qqueue-members.html
/usr/share/doc/qt6/qtcore/qqueue.html
/usr/share/doc/qt6/qtcore/qrandomgenerator-members.html
/usr/share/doc/qt6/qtcore/qrandomgenerator.html
/usr/share/doc/qt6/qtcore/qrandomgenerator64-members.html
/usr/share/doc/qt6/qtcore/qrandomgenerator64.html
/usr/share/doc/qt6/qtcore/qreadlocker-members.html
/usr/share/doc/qt6/qtcore/qreadlocker.html
/usr/share/doc/qt6/qtcore/qreadwritelock-members.html
/usr/share/doc/qt6/qtcore/qreadwritelock.html
/usr/share/doc/qt6/qtcore/qrect-members.html
/usr/share/doc/qt6/qtcore/qrect.html
/usr/share/doc/qt6/qtcore/qrectf-members.html
/usr/share/doc/qt6/qtcore/qrectf.html
/usr/share/doc/qt6/qtcore/qrecursivemutex-members.html
/usr/share/doc/qt6/qtcore/qrecursivemutex.html
/usr/share/doc/qt6/qtcore/qregularexpression-members.html
/usr/share/doc/qt6/qtcore/qregularexpression-obsolete.html
/usr/share/doc/qt6/qtcore/qregularexpression.html
/usr/share/doc/qt6/qtcore/qregularexpressionmatch-members.html
/usr/share/doc/qt6/qtcore/qregularexpressionmatch.html
/usr/share/doc/qt6/qtcore/qregularexpressionmatchiterator-members.html
/usr/share/doc/qt6/qtcore/qregularexpressionmatchiterator.html
/usr/share/doc/qt6/qtcore/qresource-members.html
/usr/share/doc/qt6/qtcore/qresource.html
/usr/share/doc/qt6/qtcore/qromancalendar.html
/usr/share/doc/qt6/qtcore/qrunnable-members.html
/usr/share/doc/qt6/qtcore/qrunnable.html
/usr/share/doc/qt6/qtcore/qsavefile-members.html
/usr/share/doc/qt6/qtcore/qsavefile.html
/usr/share/doc/qt6/qtcore/qscopedarraypointer-members.html
/usr/share/doc/qt6/qtcore/qscopedarraypointer-obsolete.html
/usr/share/doc/qt6/qtcore/qscopedarraypointer.html
/usr/share/doc/qt6/qtcore/qscopedpointer-members.html
/usr/share/doc/qt6/qtcore/qscopedpointer-obsolete.html
/usr/share/doc/qt6/qtcore/qscopedpointer.html
/usr/share/doc/qt6/qtcore/qscopedpropertyupdategroup-members.html
/usr/share/doc/qt6/qtcore/qscopedpropertyupdategroup.html
/usr/share/doc/qt6/qtcore/qscopedvaluerollback-members.html
/usr/share/doc/qt6/qtcore/qscopedvaluerollback.html
/usr/share/doc/qt6/qtcore/qscopeguard-members.html
/usr/share/doc/qt6/qtcore/qscopeguard.html
/usr/share/doc/qt6/qtcore/qsemaphore-members.html
/usr/share/doc/qt6/qtcore/qsemaphore.html
/usr/share/doc/qt6/qtcore/qsemaphorereleaser-members.html
/usr/share/doc/qt6/qtcore/qsemaphorereleaser.html
/usr/share/doc/qt6/qtcore/qsequentialanimationgroup-members.html
/usr/share/doc/qt6/qtcore/qsequentialanimationgroup.html
/usr/share/doc/qt6/qtcore/qsequentialiterable-members.html
/usr/share/doc/qt6/qtcore/qsequentialiterable.html
/usr/share/doc/qt6/qtcore/qset-const-iterator-members.html
/usr/share/doc/qt6/qtcore/qset-const-iterator.html
/usr/share/doc/qt6/qtcore/qset-iterator-members.html
/usr/share/doc/qt6/qtcore/qset-iterator.html
/usr/share/doc/qt6/qtcore/qset-members.html
/usr/share/doc/qt6/qtcore/qset.html
/usr/share/doc/qt6/qtcore/qsetiterator-members.html
/usr/share/doc/qt6/qtcore/qsetiterator.html
/usr/share/doc/qt6/qtcore/qsettings-members.html
/usr/share/doc/qt6/qtcore/qsettings.html
/usr/share/doc/qt6/qtcore/qshareddata-members.html
/usr/share/doc/qt6/qtcore/qshareddata.html
/usr/share/doc/qt6/qtcore/qshareddatapointer-members.html
/usr/share/doc/qt6/qtcore/qshareddatapointer.html
/usr/share/doc/qt6/qtcore/qsharedmemory-members.html
/usr/share/doc/qt6/qtcore/qsharedmemory.html
/usr/share/doc/qt6/qtcore/qsharedpointer-members.html
/usr/share/doc/qt6/qtcore/qsharedpointer.html
/usr/share/doc/qt6/qtcore/qsignalblocker-members.html
/usr/share/doc/qt6/qtcore/qsignalblocker.html
/usr/share/doc/qt6/qtcore/qsignalmapper-members.html
/usr/share/doc/qt6/qtcore/qsignalmapper.html
/usr/share/doc/qt6/qtcore/qsize-members.html
/usr/share/doc/qt6/qtcore/qsize.html
/usr/share/doc/qt6/qtcore/qsizef-members.html
/usr/share/doc/qt6/qtcore/qsizef.html
/usr/share/doc/qt6/qtcore/qsocketnotifier-members.html
/usr/share/doc/qt6/qtcore/qsocketnotifier-obsolete.html
/usr/share/doc/qt6/qtcore/qsocketnotifier.html
/usr/share/doc/qt6/qtcore/qsortfilterproxymodel-members.html
/usr/share/doc/qt6/qtcore/qsortfilterproxymodel.html
/usr/share/doc/qt6/qtcore/qstack-members.html
/usr/share/doc/qt6/qtcore/qstack.html
/usr/share/doc/qt6/qtcore/qstandardpaths-members.html
/usr/share/doc/qt6/qtcore/qstandardpaths.html
/usr/share/doc/qt6/qtcore/qstaticbytearraymatcher-members.html
/usr/share/doc/qt6/qtcore/qstaticbytearraymatcher.html
/usr/share/doc/qt6/qtcore/qstaticplugin-members.html
/usr/share/doc/qt6/qtcore/qstaticplugin.html
/usr/share/doc/qt6/qtcore/qstorageinfo-members.html
/usr/share/doc/qt6/qtcore/qstorageinfo.html
/usr/share/doc/qt6/qtcore/qstring-members.html
/usr/share/doc/qt6/qtcore/qstring-obsolete.html
/usr/share/doc/qt6/qtcore/qstring.html
/usr/share/doc/qt6/qtcore/qstringconverter-members.html
/usr/share/doc/qt6/qtcore/qstringconverter.html
/usr/share/doc/qt6/qtcore/qstringdecoder-members.html
/usr/share/doc/qt6/qtcore/qstringdecoder.html
/usr/share/doc/qt6/qtcore/qstringencoder-members.html
/usr/share/doc/qt6/qtcore/qstringencoder.html
/usr/share/doc/qt6/qtcore/qstringlist-members.html
/usr/share/doc/qt6/qtcore/qstringlist.html
/usr/share/doc/qt6/qtcore/qstringlistmodel-members.html
/usr/share/doc/qt6/qtcore/qstringlistmodel.html
/usr/share/doc/qt6/qtcore/qstringmatcher-members.html
/usr/share/doc/qt6/qtcore/qstringmatcher.html
/usr/share/doc/qt6/qtcore/qstringtokenizer-members.html
/usr/share/doc/qt6/qtcore/qstringtokenizer.html
/usr/share/doc/qt6/qtcore/qstringview-members.html
/usr/share/doc/qt6/qtcore/qstringview-obsolete.html
/usr/share/doc/qt6/qtcore/qstringview.html
/usr/share/doc/qt6/qtcore/qsysinfo-members.html
/usr/share/doc/qt6/qtcore/qsysinfo.html
/usr/share/doc/qt6/qtcore/qsystemsemaphore-members.html
/usr/share/doc/qt6/qtcore/qsystemsemaphore.html
/usr/share/doc/qt6/qtcore/qt-add-bigresources.html
/usr/share/doc/qt6/qtcore/qt-add-binary-resources.html
/usr/share/doc/qt6/qtcore/qt-add-executable.html
/usr/share/doc/qt6/qtcore/qt-add-library.html
/usr/share/doc/qt6/qtcore/qt-add-plugin.html
/usr/share/doc/qt6/qtcore/qt-add-resources.html
/usr/share/doc/qt6/qtcore/qt-allow-non-utf8-sources.html
/usr/share/doc/qt6/qtcore/qt-android-add-apk-target.html
/usr/share/doc/qt6/qtcore/qt-android-apply-arch-suffix.html
/usr/share/doc/qt6/qtcore/qt-android-generate-deployment-settings.html
/usr/share/doc/qt6/qtcore/qt-cmake-policy-qtp0002.html
/usr/share/doc/qt6/qtcore/qt-deploy-qt-conf.html
/usr/share/doc/qt6/qtcore/qt-deploy-runtime-dependencies.html
/usr/share/doc/qt6/qtcore/qt-deploy-translations.html
/usr/share/doc/qt6/qtcore/qt-disable-unicode-defines.html
/usr/share/doc/qt6/qtcore/qt-extract-metatypes.html
/usr/share/doc/qt6/qtcore/qt-finalize-project.html
/usr/share/doc/qt6/qtcore/qt-finalize-target.html
/usr/share/doc/qt6/qtcore/qt-generate-deploy-app-script.html
/usr/share/doc/qt6/qtcore/qt-generate-deploy-script.html
/usr/share/doc/qt6/qtcore/qt-generate-moc.html
/usr/share/doc/qt6/qtcore/qt-import-plugins.html
/usr/share/doc/qt6/qtcore/qt-literals-stringliterals.html
/usr/share/doc/qt6/qtcore/qt-literals.html
/usr/share/doc/qt6/qtcore/qt-policy.html
/usr/share/doc/qt6/qtcore/qt-set-finalizer-mode.html
/usr/share/doc/qt6/qtcore/qt-standard-project-setup.html
/usr/share/doc/qt6/qtcore/qt-wrap-cpp.html
/usr/share/doc/qt6/qtcore/qt.html
/usr/share/doc/qt6/qtcore/qtaggediterator-members.html
/usr/share/doc/qt6/qtcore/qtaggediterator.html
/usr/share/doc/qt6/qtcore/qtalgorithms.html
/usr/share/doc/qt6/qtcore/qtandroidprivate.html
/usr/share/doc/qt6/qtcore/qtassert-qtcore-proxy.html
/usr/share/doc/qt6/qtcore/qtcborcommon.html
/usr/share/doc/qt6/qtcore/qtclasshelpermacros-qtcore-proxy.html
/usr/share/doc/qt6/qtcore/qtcompilerdetection-obsolete.html
/usr/share/doc/qt6/qtcore/qtcompilerdetection.html
/usr/share/doc/qt6/qtcore/qtcore-attribution-android-gradle-wrapper.html
/usr/share/doc/qt6/qtcore/qtcore-attribution-blake2.html
/usr/share/doc/qt6/qtcore/qtcore-attribution-doubleconversion.html
/usr/share/doc/qt6/qtcore/qtcore-attribution-easing.html
/usr/share/doc/qt6/qtcore/qtcore-attribution-extra-cmake-modules.html
/usr/share/doc/qt6/qtcore/qtcore-attribution-forkfd.html
/usr/share/doc/qt6/qtcore/qtcore-attribution-kwin.html
/usr/share/doc/qt6/qtcore/qtcore-attribution-md4.html
/usr/share/doc/qt6/qtcore/qtcore-attribution-md5.html
/usr/share/doc/qt6/qtcore/qtcore-attribution-pcre2-sljit.html
/usr/share/doc/qt6/qtcore/qtcore-attribution-pcre2.html
/usr/share/doc/qt6/qtcore/qtcore-attribution-qeventdispatcher-cf.html
/usr/share/doc/qt6/qtcore/qtcore-attribution-rfc6234.html
/usr/share/doc/qt6/qtcore/qtcore-attribution-sha1.html
/usr/share/doc/qt6/qtcore/qtcore-attribution-sha3-endian.html
/usr/share/doc/qt6/qtcore/qtcore-attribution-sha3-keccak.html
/usr/share/doc/qt6/qtcore/qtcore-attribution-siphash.html
/usr/share/doc/qt6/qtcore/qtcore-attribution-tinycbor.html
/usr/share/doc/qt6/qtcore/qtcore-attribution-unicode-character-database.html
/usr/share/doc/qt6/qtcore/qtcore-attribution-unicode-cldr.html
/usr/share/doc/qt6/qtcore/qtcore-attribution-zlib.html
/usr/share/doc/qt6/qtcore/qtcore-bindableproperties-example.html
/usr/share/doc/qt6/qtcore/qtcore-changes-qt6.html
/usr/share/doc/qt6/qtcore/qtcore-index.html
/usr/share/doc/qt6/qtcore/qtcore-ipc-localfortuneclient-example.html
/usr/share/doc/qt6/qtcore/qtcore-ipc-localfortuneserver-example.html
/usr/share/doc/qt6/qtcore/qtcore-ipc-sharedmemory-example.html
/usr/share/doc/qt6/qtcore/qtcore-mimetypes-mimetypebrowser-example.html
/usr/share/doc/qt6/qtcore/qtcore-module.html
/usr/share/doc/qt6/qtcore/qtcore-platform-androidnotifier-example.html
/usr/share/doc/qt6/qtcore/qtcore-serialization-cbordump-example.html
/usr/share/doc/qt6/qtcore/qtcore-serialization-convert-example.html
/usr/share/doc/qt6/qtcore/qtcore-serialization-savegame-example.html
/usr/share/doc/qt6/qtcore/qtcore-serialization-streambookmarks-example.html
/usr/share/doc/qt6/qtcore/qtcore-threads-mandelbrot-example.html
/usr/share/doc/qt6/qtcore/qtcore-threads-queuedcustomtype-example.html
/usr/share/doc/qt6/qtcore/qtcore-threads-semaphores-example.html
/usr/share/doc/qt6/qtcore/qtcore-threads-waitconditions-example.html
/usr/share/doc/qt6/qtcore/qtcore-tools-contiguouscache-example.html
/usr/share/doc/qt6/qtcore/qtcore.index
/usr/share/doc/qt6/qtcore/qtcore.qhp
/usr/share/doc/qt6/qtcore/qtcore.qhp.sha1
/usr/share/doc/qt6/qtcore/qtcoreprivate-module.html
/usr/share/doc/qt6/qtcore/qtdarwinhelpers-qtcore-proxy.html
/usr/share/doc/qt6/qtcore/qtdeprecationmarkers-obsolete.html
/usr/share/doc/qt6/qtcore/qtdeprecationmarkers.html
/usr/share/doc/qt6/qtcore/qtemporarydir-members.html
/usr/share/doc/qt6/qtcore/qtemporarydir.html
/usr/share/doc/qt6/qtcore/qtemporaryfile-members.html
/usr/share/doc/qt6/qtcore/qtemporaryfile.html
/usr/share/doc/qt6/qtcore/qtendian.html
/usr/share/doc/qt6/qtcore/qtenvironmentvariables-qtcore-proxy.html
/usr/share/doc/qt6/qtcore/qtextboundaryfinder-members.html
/usr/share/doc/qt6/qtcore/qtextboundaryfinder.html
/usr/share/doc/qt6/qtcore/qtextstream-members.html
/usr/share/doc/qt6/qtcore/qtextstream.html
/usr/share/doc/qt6/qtcore/qtfuture-obsolete.html
/usr/share/doc/qt6/qtcore/qtfuture-whenanyresult-members.html
/usr/share/doc/qt6/qtcore/qtfuture-whenanyresult.html
/usr/share/doc/qt6/qtcore/qtfuture.html
/usr/share/doc/qt6/qtcore/qtglobal-obsolete.html
/usr/share/doc/qt6/qtcore/qtglobal.html
/usr/share/doc/qt6/qtcore/qthread-members.html
/usr/share/doc/qt6/qtcore/qthread.html
/usr/share/doc/qt6/qtcore/qthreadpool-members.html
/usr/share/doc/qt6/qtcore/qthreadpool.html
/usr/share/doc/qt6/qtcore/qthreadstorage-members.html
/usr/share/doc/qt6/qtcore/qthreadstorage.html
/usr/share/doc/qt6/qtcore/qtime-members.html
/usr/share/doc/qt6/qtcore/qtime.html
/usr/share/doc/qt6/qtcore/qtimeline-members.html
/usr/share/doc/qt6/qtcore/qtimeline.html
/usr/share/doc/qt6/qtcore/qtimer-members.html
/usr/share/doc/qt6/qtcore/qtimer.html
/usr/share/doc/qt6/qtcore/qtimerevent-members.html
/usr/share/doc/qt6/qtcore/qtimerevent.html
/usr/share/doc/qt6/qtcore/qtimezone-members.html
/usr/share/doc/qt6/qtcore/qtimezone-obsolete.html
/usr/share/doc/qt6/qtcore/qtimezone-offsetdata.html
/usr/share/doc/qt6/qtcore/qtimezone.html
/usr/share/doc/qt6/qtcore/qtliterals-obsolete.html
/usr/share/doc/qt6/qtcore/qtliterals.html
/usr/share/doc/qt6/qtcore/qtlogging.html
/usr/share/doc/qt6/qtcore/qtmath.html
/usr/share/doc/qt6/qtcore/qtminmax-qtcore-proxy.html
/usr/share/doc/qt6/qtcore/qtnumeric.html
/usr/share/doc/qt6/qtcore/qtplugin.html
/usr/share/doc/qt6/qtcore/qtpreprocessorsupport-qtcore-proxy.html
/usr/share/doc/qt6/qtcore/qtprocessordetection.html
/usr/share/doc/qt6/qtcore/qtranslator-members.html
/usr/share/doc/qt6/qtcore/qtranslator.html
/usr/share/doc/qt6/qtcore/qtransposeproxymodel-members.html
/usr/share/doc/qt6/qtcore/qtransposeproxymodel.html
/usr/share/doc/qt6/qtcore/qtresource-qtcore-proxy.html
/usr/share/doc/qt6/qtcore/qtserialization.html
/usr/share/doc/qt6/qtcore/qtswap-qtcore-proxy.html
/usr/share/doc/qt6/qtcore/qtsystemdetection.html
/usr/share/doc/qt6/qtcore/qttranslation-qtcore-proxy.html
/usr/share/doc/qt6/qtcore/qttypes.html
/usr/share/doc/qt6/qtcore/qttypetraits-obsolete.html
/usr/share/doc/qt6/qtcore/qttypetraits.html
/usr/share/doc/qt6/qtcore/qtversion-qtcore-proxy.html
/usr/share/doc/qt6/qtcore/qtversionchecks-qtcore-proxy.html
/usr/share/doc/qt6/qtcore/qtypeinfo-qtcore-proxy.html
/usr/share/doc/qt6/qtcore/qtyperevision-members.html
/usr/share/doc/qt6/qtcore/qtyperevision.html
/usr/share/doc/qt6/qtcore/qunhandledexception-members.html
/usr/share/doc/qt6/qtcore/qunhandledexception.html
/usr/share/doc/qt6/qtcore/quntypedbindable-members.html
/usr/share/doc/qt6/qtcore/quntypedbindable.html
/usr/share/doc/qt6/qtcore/qurl-members.html
/usr/share/doc/qt6/qtcore/qurl.html
/usr/share/doc/qt6/qtcore/qurlquery-members.html
/usr/share/doc/qt6/qtcore/qurlquery.html
/usr/share/doc/qt6/qtcore/qutf8stringview-members.html
/usr/share/doc/qt6/qtcore/qutf8stringview-obsolete.html
/usr/share/doc/qt6/qtcore/qutf8stringview.html
/usr/share/doc/qt6/qtcore/quuid-id128bytes.html
/usr/share/doc/qt6/qtcore/quuid-members.html
/usr/share/doc/qt6/qtcore/quuid.html
/usr/share/doc/qt6/qtcore/qvariant-members.html
/usr/share/doc/qt6/qtcore/qvariant-obsolete.html
/usr/share/doc/qt6/qtcore/qvariant.html
/usr/share/doc/qt6/qtcore/qvariantanimation-members.html
/usr/share/doc/qt6/qtcore/qvariantanimation.html
/usr/share/doc/qt6/qtcore/qvariantconstpointer-members.html
/usr/share/doc/qt6/qtcore/qvariantconstpointer.html
/usr/share/doc/qt6/qtcore/qvariantpointer-members.html
/usr/share/doc/qt6/qtcore/qvariantpointer.html
/usr/share/doc/qt6/qtcore/qvariantref-members.html
/usr/share/doc/qt6/qtcore/qvariantref.html
/usr/share/doc/qt6/qtcore/qvarlengtharray-members.html
/usr/share/doc/qt6/qtcore/qvarlengtharray-obsolete.html
/usr/share/doc/qt6/qtcore/qvarlengtharray.html
/usr/share/doc/qt6/qtcore/qvector-members.html
/usr/share/doc/qt6/qtcore/qvector.html
/usr/share/doc/qt6/qtcore/qversionnumber-members.html
/usr/share/doc/qt6/qtcore/qversionnumber.html
/usr/share/doc/qt6/qtcore/qwaitcondition-members.html
/usr/share/doc/qt6/qtcore/qwaitcondition.html
/usr/share/doc/qt6/qtcore/qweakpointer-members.html
/usr/share/doc/qt6/qtcore/qweakpointer-obsolete.html
/usr/share/doc/qt6/qtcore/qweakpointer.html
/usr/share/doc/qt6/qtcore/qwineventnotifier-members.html
/usr/share/doc/qt6/qtcore/qwineventnotifier.html
/usr/share/doc/qt6/qtcore/qwritelocker-members.html
/usr/share/doc/qt6/qtcore/qwritelocker.html
/usr/share/doc/qt6/qtcore/qxmlstreamattribute-members.html
/usr/share/doc/qt6/qtcore/qxmlstreamattribute.html
/usr/share/doc/qt6/qtcore/qxmlstreamattributes-members.html
/usr/share/doc/qt6/qtcore/qxmlstreamattributes.html
/usr/share/doc/qt6/qtcore/qxmlstreamentitydeclaration-members.html
/usr/share/doc/qt6/qtcore/qxmlstreamentitydeclaration.html
/usr/share/doc/qt6/qtcore/qxmlstreamentityresolver-members.html
/usr/share/doc/qt6/qtcore/qxmlstreamentityresolver.html
/usr/share/doc/qt6/qtcore/qxmlstreamnamespacedeclaration-members.html
/usr/share/doc/qt6/qtcore/qxmlstreamnamespacedeclaration.html
/usr/share/doc/qt6/qtcore/qxmlstreamnotationdeclaration-members.html
/usr/share/doc/qt6/qtcore/qxmlstreamnotationdeclaration.html
/usr/share/doc/qt6/qtcore/qxmlstreamreader-members.html
/usr/share/doc/qt6/qtcore/qxmlstreamreader.html
/usr/share/doc/qt6/qtcore/qxmlstreamwriter-members.html
/usr/share/doc/qt6/qtcore/qxmlstreamwriter.html
/usr/share/doc/qt6/qtcore/resources.html
/usr/share/doc/qt6/qtcore/shared-memory.html
/usr/share/doc/qt6/qtcore/shared.html
/usr/share/doc/qt6/qtcore/signalsandslots.html
/usr/share/doc/qt6/qtcore/style
/usr/share/doc/qt6/qtcore/style/offline-dark.css
/usr/share/doc/qt6/qtcore/style/offline-simple.css
/usr/share/doc/qt6/qtcore/style/offline.css
/usr/share/doc/qt6/qtcore/timers.html
/usr/share/doc/qt6/qtcore5compat/codec-big5.html
/usr/share/doc/qt6/qtcore5compat/codec-big5hkscs.html
/usr/share/doc/qt6/qtcore5compat/codec-eucjp.html
/usr/share/doc/qt6/qtcore5compat/codec-euckr.html
/usr/share/doc/qt6/qtcore5compat/codec-gbk.html
/usr/share/doc/qt6/qtcore5compat/codec-sjis.html
/usr/share/doc/qt6/qtcore5compat/codec-tscii.html
/usr/share/doc/qt6/qtcore5compat/codecs-jis.html
/usr/share/doc/qt6/qtcore5compat/images
/usr/share/doc/qt6/qtcore5compat/images/arrow_bc.png
/usr/share/doc/qt6/qtcore5compat/images/bgrContent.png
/usr/share/doc/qt6/qtcore5compat/images/btn_next.png
/usr/share/doc/qt6/qtcore5compat/images/btn_prev.png
/usr/share/doc/qt6/qtcore5compat/images/bullet_dn.png
/usr/share/doc/qt6/qtcore5compat/images/bullet_sq.png
/usr/share/doc/qt6/qtcore5compat/images/home.png
/usr/share/doc/qt6/qtcore5compat/images/ico_note.png
/usr/share/doc/qt6/qtcore5compat/images/ico_note_attention.png
/usr/share/doc/qt6/qtcore5compat/images/ico_out.png
/usr/share/doc/qt6/qtcore5compat/images/javaiterators1.png
/usr/share/doc/qt6/qtcore5compat/images/logo.png
/usr/share/doc/qt6/qtcore5compat/qbinaryjson.html
/usr/share/doc/qt6/qtcore5compat/qhash-qtcore5compat-proxy.html
/usr/share/doc/qt6/qtcore5compat/qlinkedlist-const-iterator-members.html
/usr/share/doc/qt6/qtcore5compat/qlinkedlist-const-iterator.html
/usr/share/doc/qt6/qtcore5compat/qlinkedlist-iterator-members.html
/usr/share/doc/qt6/qtcore5compat/qlinkedlist-iterator.html
/usr/share/doc/qt6/qtcore5compat/qlinkedlist-members.html
/usr/share/doc/qt6/qtcore5compat/qlinkedlist.html
/usr/share/doc/qt6/qtcore5compat/qlinkedlistiterator-members.html
/usr/share/doc/qt6/qtcore5compat/qlinkedlistiterator.html
/usr/share/doc/qt6/qtcore5compat/qmutablelinkedlistiterator-members.html
/usr/share/doc/qt6/qtcore5compat/qmutablelinkedlistiterator.html
/usr/share/doc/qt6/qtcore5compat/qregexp-members.html
/usr/share/doc/qt6/qtcore5compat/qregexp.html
/usr/share/doc/qt6/qtcore5compat/qstringref-members.html
/usr/share/doc/qt6/qtcore5compat/qstringref.html
/usr/share/doc/qt6/qtcore5compat/qtcore5-index.html
/usr/share/doc/qt6/qtcore5compat/qtcore5compat-attribution-qbig5codecs.html
/usr/share/doc/qt6/qtcore5compat/qtcore5compat-attribution-qbkcodec.html
/usr/share/doc/qt6/qtcore5compat/qtcore5compat-attribution-qeucjpcodec.html
/usr/share/doc/qt6/qtcore5compat/qtcore5compat-attribution-qeuckrcodec.html
/usr/share/doc/qt6/qtcore5compat/qtcore5compat-attribution-qjiscodec.html
/usr/share/doc/qt6/qtcore5compat/qtcore5compat-attribution-qsjiscodec.html
/usr/share/doc/qt6/qtcore5compat/qtcore5compat-attribution-qtsciicodec.html
/usr/share/doc/qt6/qtcore5compat/qtcore5compat-module.html
/usr/share/doc/qt6/qtcore5compat/qtcore5compat.index
/usr/share/doc/qt6/qtcore5compat/qtcore5compat.qhp
/usr/share/doc/qt6/qtcore5compat/qtcore5compat.qhp.sha1
/usr/share/doc/qt6/qtcore5compat/qtextcodec-members.html
/usr/share/doc/qt6/qtcore5compat/qtextcodec-obsolete.html
/usr/share/doc/qt6/qtcore5compat/qtextcodec.html
/usr/share/doc/qt6/qtcore5compat/qtextdecoder-members.html
/usr/share/doc/qt6/qtcore5compat/qtextdecoder.html
/usr/share/doc/qt6/qtcore5compat/qtextencoder-members.html
/usr/share/doc/qt6/qtcore5compat/qtextencoder.html
/usr/share/doc/qt6/qtcore5compat/qxmlattributes-members.html
/usr/share/doc/qt6/qtcore5compat/qxmlattributes.html
/usr/share/doc/qt6/qtcore5compat/qxmlcontenthandler-members.html
/usr/share/doc/qt6/qtcore5compat/qxmlcontenthandler.html
/usr/share/doc/qt6/qtcore5compat/qxmldeclhandler-members.html
/usr/share/doc/qt6/qtcore5compat/qxmldeclhandler.html
/usr/share/doc/qt6/qtcore5compat/qxmldefaulthandler-members.html
/usr/share/doc/qt6/qtcore5compat/qxmldefaulthandler.html
/usr/share/doc/qt6/qtcore5compat/qxmldtdhandler-members.html
/usr/share/doc/qt6/qtcore5compat/qxmldtdhandler.html
/usr/share/doc/qt6/qtcore5compat/qxmlentityresolver-members.html
/usr/share/doc/qt6/qtcore5compat/qxmlentityresolver.html
/usr/share/doc/qt6/qtcore5compat/qxmlerrorhandler-members.html
/usr/share/doc/qt6/qtcore5compat/qxmlerrorhandler.html
/usr/share/doc/qt6/qtcore5compat/qxmlinputsource-members.html
/usr/share/doc/qt6/qtcore5compat/qxmlinputsource.html
/usr/share/doc/qt6/qtcore5compat/qxmllexicalhandler-members.html
/usr/share/doc/qt6/qtcore5compat/qxmllexicalhandler.html
/usr/share/doc/qt6/qtcore5compat/qxmllocator-members.html
/usr/share/doc/qt6/qtcore5compat/qxmllocator.html
/usr/share/doc/qt6/qtcore5compat/qxmlnamespacesupport-members.html
/usr/share/doc/qt6/qtcore5compat/qxmlnamespacesupport.html
/usr/share/doc/qt6/qtcore5compat/qxmlparseexception-members.html
/usr/share/doc/qt6/qtcore5compat/qxmlparseexception.html
/usr/share/doc/qt6/qtcore5compat/qxmlreader-members.html
/usr/share/doc/qt6/qtcore5compat/qxmlreader-obsolete.html
/usr/share/doc/qt6/qtcore5compat/qxmlreader.html
/usr/share/doc/qt6/qtcore5compat/qxmlsimplereader-members.html
/usr/share/doc/qt6/qtcore5compat/qxmlsimplereader.html
/usr/share/doc/qt6/qtcore5compat/style
/usr/share/doc/qt6/qtcore5compat/style/offline-dark.css
/usr/share/doc/qt6/qtcore5compat/style/offline-simple.css
/usr/share/doc/qt6/qtcore5compat/style/offline.css
/usr/share/doc/qt6/qtdatavis3d/datavisualization-examples.html
/usr/share/doc/qt6/qtdatavis3d/examples-manifest.xml
/usr/share/doc/qt6/qtdatavis3d/images
/usr/share/doc/qt6/qtdatavis3d/images/arrow_bc.png
/usr/share/doc/qt6/qtdatavis3d/images/bgrContent.png
/usr/share/doc/qt6/qtdatavis3d/images/btn_next.png
/usr/share/doc/qt6/qtdatavis3d/images/btn_prev.png
/usr/share/doc/qt6/qtdatavis3d/images/bullet_dn.png
/usr/share/doc/qt6/qtdatavis3d/images/bullet_sq.png
/usr/share/doc/qt6/qtdatavis3d/images/graphgallery-example.png
/usr/share/doc/qt6/qtdatavis3d/images/home.png
/usr/share/doc/qt6/qtdatavis3d/images/ico_note.png
/usr/share/doc/qt6/qtdatavis3d/images/ico_note_attention.png
/usr/share/doc/qt6/qtdatavis3d/images/ico_out.png
/usr/share/doc/qt6/qtdatavis3d/images/logo.png
/usr/share/doc/qt6/qtdatavis3d/images/q3dbars-minimal.png
/usr/share/doc/qt6/qtdatavis3d/images/q3dscatter-minimal.png
/usr/share/doc/qt6/qtdatavis3d/images/q3dsurface-minimal.png
/usr/share/doc/qt6/qtdatavis3d/images/qmlaxishandling-example.png
/usr/share/doc/qt6/qtdatavis3d/images/qmlbars-example.png
/usr/share/doc/qt6/qtdatavis3d/images/qmlscatter-example.png
/usr/share/doc/qt6/qtdatavis3d/images/qmlsurfacegallery-example.png
/usr/share/doc/qt6/qtdatavis3d/images/volumetric-example.png
/usr/share/doc/qt6/qtdatavis3d/q3dbars-members.html
/usr/share/doc/qt6/qtdatavis3d/q3dbars.html
/usr/share/doc/qt6/qtdatavis3d/q3dcamera-members.html
/usr/share/doc/qt6/qtdatavis3d/q3dcamera.html
/usr/share/doc/qt6/qtdatavis3d/q3dinputhandler-members.html
/usr/share/doc/qt6/qtdatavis3d/q3dinputhandler.html
/usr/share/doc/qt6/qtdatavis3d/q3dlight-members.html
/usr/share/doc/qt6/qtdatavis3d/q3dlight.html
/usr/share/doc/qt6/qtdatavis3d/q3dobject-members.html
/usr/share/doc/qt6/qtdatavis3d/q3dobject.html
/usr/share/doc/qt6/qtdatavis3d/q3dscatter-members.html
/usr/share/doc/qt6/qtdatavis3d/q3dscatter.html
/usr/share/doc/qt6/qtdatavis3d/q3dscene-members.html
/usr/share/doc/qt6/qtdatavis3d/q3dscene.html
/usr/share/doc/qt6/qtdatavis3d/q3dsurface-members.html
/usr/share/doc/qt6/qtdatavis3d/q3dsurface.html
/usr/share/doc/qt6/qtdatavis3d/q3dtheme-members.html
/usr/share/doc/qt6/qtdatavis3d/q3dtheme.html
/usr/share/doc/qt6/qtdatavis3d/qabstract3daxis-members.html
/usr/share/doc/qt6/qtdatavis3d/qabstract3daxis.html
/usr/share/doc/qt6/qtdatavis3d/qabstract3dgraph-members.html
/usr/share/doc/qt6/qtdatavis3d/qabstract3dgraph.html
/usr/share/doc/qt6/qtdatavis3d/qabstract3dinputhandler-members.html
/usr/share/doc/qt6/qtdatavis3d/qabstract3dinputhandler.html
/usr/share/doc/qt6/qtdatavis3d/qabstract3dseries-members.html
/usr/share/doc/qt6/qtdatavis3d/qabstract3dseries.html
/usr/share/doc/qt6/qtdatavis3d/qabstractdataproxy-members.html
/usr/share/doc/qt6/qtdatavis3d/qabstractdataproxy.html
/usr/share/doc/qt6/qtdatavis3d/qbar3dseries-members.html
/usr/share/doc/qt6/qtdatavis3d/qbar3dseries.html
/usr/share/doc/qt6/qtdatavis3d/qbardataitem-members.html
/usr/share/doc/qt6/qtdatavis3d/qbardataitem.html
/usr/share/doc/qt6/qtdatavis3d/qbardataproxy-members.html
/usr/share/doc/qt6/qtdatavis3d/qbardataproxy.html
/usr/share/doc/qt6/qtdatavis3d/qcategory3daxis-members.html
/usr/share/doc/qt6/qtdatavis3d/qcategory3daxis.html
/usr/share/doc/qt6/qtdatavis3d/qcustom3ditem-members.html
/usr/share/doc/qt6/qtdatavis3d/qcustom3ditem.html
/usr/share/doc/qt6/qtdatavis3d/qcustom3dlabel-members.html
/usr/share/doc/qt6/qtdatavis3d/qcustom3dlabel.html
/usr/share/doc/qt6/qtdatavis3d/qcustom3dvolume-members.html
/usr/share/doc/qt6/qtdatavis3d/qcustom3dvolume.html
/usr/share/doc/qt6/qtdatavis3d/qheightmapsurfacedataproxy-members.html
/usr/share/doc/qt6/qtdatavis3d/qheightmapsurfacedataproxy.html
/usr/share/doc/qt6/qtdatavis3d/qitemmodelbardataproxy-members.html
/usr/share/doc/qt6/qtdatavis3d/qitemmodelbardataproxy.html
/usr/share/doc/qt6/qtdatavis3d/qitemmodelscatterdataproxy-members.html
/usr/share/doc/qt6/qtdatavis3d/qitemmodelscatterdataproxy.html
/usr/share/doc/qt6/qtdatavis3d/qitemmodelsurfacedataproxy-members.html
/usr/share/doc/qt6/qtdatavis3d/qitemmodelsurfacedataproxy.html
/usr/share/doc/qt6/qtdatavis3d/qlogvalue3daxisformatter-members.html
/usr/share/doc/qt6/qtdatavis3d/qlogvalue3daxisformatter.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-abstract3dseries-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-abstract3dseries.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-abstractaxis3d-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-abstractaxis3d.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-abstractdataproxy-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-abstractdataproxy.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-abstractgraph3d-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-abstractgraph3d-obsolete.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-abstractgraph3d.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-abstractinputhandler3d-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-abstractinputhandler3d.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-bar3dseries-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-bar3dseries.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-bardataproxy-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-bardataproxy.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-bars3d-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-bars3d.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-camera3d-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-camera3d.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-categoryaxis3d-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-categoryaxis3d.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-colorgradient-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-colorgradient.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-colorgradientstop-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-colorgradientstop.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-custom3ditem-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-custom3ditem.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-custom3dlabel-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-custom3dlabel.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-custom3dvolume-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-custom3dvolume.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-heightmapsurfacedataproxy-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-heightmapsurfacedataproxy.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-inputhandler3d-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-inputhandler3d.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-itemmodelbardataproxy-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-itemmodelbardataproxy.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-itemmodelscatterdataproxy-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-itemmodelscatterdataproxy.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-itemmodelsurfacedataproxy-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-itemmodelsurfacedataproxy.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-light3d-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-light3d.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-logvalueaxis3dformatter-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-logvalueaxis3dformatter.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-object3d-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-object3d.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-scatter3d-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-scatter3d.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-scatter3dseries-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-scatter3dseries.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-scatterdataproxy-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-scatterdataproxy.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-scene3d-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-scene3d.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-surface3d-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-surface3d.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-surface3dseries-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-surface3dseries.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-surfacedataproxy-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-surfacedataproxy.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-theme3d-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-theme3d.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-themecolor-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-themecolor.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-touchinputhandler3d-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-touchinputhandler3d.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-valueaxis3d-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-valueaxis3d.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-valueaxis3dformatter-members.html
/usr/share/doc/qt6/qtdatavis3d/qml-qtdatavisualization-valueaxis3dformatter.html
/usr/share/doc/qt6/qtdatavis3d/qscatter3dseries-members.html
/usr/share/doc/qt6/qtdatavis3d/qscatter3dseries.html
/usr/share/doc/qt6/qtdatavis3d/qscatterdataitem-members.html
/usr/share/doc/qt6/qtdatavis3d/qscatterdataitem.html
/usr/share/doc/qt6/qtdatavis3d/qscatterdataproxy-members.html
/usr/share/doc/qt6/qtdatavis3d/qscatterdataproxy.html
/usr/share/doc/qt6/qtdatavis3d/qsurface3dseries-members.html
/usr/share/doc/qt6/qtdatavis3d/qsurface3dseries.html
/usr/share/doc/qt6/qtdatavis3d/qsurfacedataitem-members.html
/usr/share/doc/qt6/qtdatavis3d/qsurfacedataitem.html
/usr/share/doc/qt6/qtdatavis3d/qsurfacedataproxy-members.html
/usr/share/doc/qt6/qtdatavis3d/qsurfacedataproxy.html
/usr/share/doc/qt6/qtdatavis3d/qtdatavis3d-graphgallery-example.html
/usr/share/doc/qt6/qtdatavis3d/qtdatavis3d-qmlaxishandling-example.html
/usr/share/doc/qt6/qtdatavis3d/qtdatavis3d-qmlbars-example.html
/usr/share/doc/qt6/qtdatavis3d/qtdatavis3d-qmlscatter-example.html
/usr/share/doc/qt6/qtdatavis3d/qtdatavis3d-qmlsurfacegallery-example.html
/usr/share/doc/qt6/qtdatavis3d/qtdatavis3d-volumetric-example.html
/usr/share/doc/qt6/qtdatavis3d/qtdatavis3d.index
/usr/share/doc/qt6/qtdatavis3d/qtdatavis3d.qhp
/usr/share/doc/qt6/qtdatavis3d/qtdatavis3d.qhp.sha1
/usr/share/doc/qt6/qtdatavis3d/qtdatavisualization-data-handling.html
/usr/share/doc/qt6/qtdatavis3d/qtdatavisualization-index.html
/usr/share/doc/qt6/qtdatavis3d/qtdatavisualization-interacting-with-data.html
/usr/share/doc/qt6/qtdatavis3d/qtdatavisualization-known-issues.html
/usr/share/doc/qt6/qtdatavis3d/qtdatavisualization-module.html
/usr/share/doc/qt6/qtdatavis3d/qtdatavisualization-overview.html
/usr/share/doc/qt6/qtdatavis3d/qtdatavisualization-qmlmodule.html
/usr/share/doc/qt6/qtdatavis3d/qtouch3dinputhandler-members.html
/usr/share/doc/qt6/qtdatavis3d/qtouch3dinputhandler.html
/usr/share/doc/qt6/qtdatavis3d/qvalue3daxis-members.html
/usr/share/doc/qt6/qtdatavis3d/qvalue3daxis.html
/usr/share/doc/qt6/qtdatavis3d/qvalue3daxisformatter-members.html
/usr/share/doc/qt6/qtdatavis3d/qvalue3daxisformatter.html
/usr/share/doc/qt6/qtdatavis3d/style
/usr/share/doc/qt6/qtdatavis3d/style/offline-dark.css
/usr/share/doc/qt6/qtdatavis3d/style/offline-simple.css
/usr/share/doc/qt6/qtdatavis3d/style/offline.css
/usr/share/doc/qt6/qtdbus/cmake-commands-qtdbus.html
/usr/share/doc/qt6/qtdbus/cmake-source-file-properties-qtdbus.html
/usr/share/doc/qt6/qtdbus/cmake-source-file-property-classname.html
/usr/share/doc/qt6/qtdbus/cmake-source-file-property-include.html
/usr/share/doc/qt6/qtdbus/cmake-source-file-property-no-namespace.html
/usr/share/doc/qt6/qtdbus/dbus-changes-qt6.html
/usr/share/doc/qt6/qtdbus/examples-dbus.html
/usr/share/doc/qt6/qtdbus/examples-manifest.xml
/usr/share/doc/qt6/qtdbus/images
/usr/share/doc/qt6/qtdbus/images/arrow_bc.png
/usr/share/doc/qt6/qtdbus/images/bgrContent.png
/usr/share/doc/qt6/qtdbus/images/btn_next.png
/usr/share/doc/qt6/qtdbus/images/btn_prev.png
/usr/share/doc/qt6/qtdbus/images/bullet_dn.png
/usr/share/doc/qt6/qtdbus/images/bullet_sq.png
/usr/share/doc/qt6/qtdbus/images/dbus-chat-example.webp
/usr/share/doc/qt6/qtdbus/images/home.png
/usr/share/doc/qt6/qtdbus/images/ico_note.png
/usr/share/doc/qt6/qtdbus/images/ico_note_attention.png
/usr/share/doc/qt6/qtdbus/images/ico_out.png
/usr/share/doc/qt6/qtdbus/images/logo.png
/usr/share/doc/qt6/qtdbus/images/qurl-ftppath.png
/usr/share/doc/qt6/qtdbus/images/remotecontrolledcar-car-example.webp
/usr/share/doc/qt6/qtdbus/qdbus.html
/usr/share/doc/qt6/qtdbus/qdbusabstractadaptor-members.html
/usr/share/doc/qt6/qtdbus/qdbusabstractadaptor.html
/usr/share/doc/qt6/qtdbus/qdbusabstractinterface-members.html
/usr/share/doc/qt6/qtdbus/qdbusabstractinterface.html
/usr/share/doc/qt6/qtdbus/qdbusargument-members.html
/usr/share/doc/qt6/qtdbus/qdbusargument.html
/usr/share/doc/qt6/qtdbus/qdbusconnection-members.html
/usr/share/doc/qt6/qtdbus/qdbusconnection-obsolete.html
/usr/share/doc/qt6/qtdbus/qdbusconnection.html
/usr/share/doc/qt6/qtdbus/qdbusconnectioninterface-members.html
/usr/share/doc/qt6/qtdbus/qdbusconnectioninterface-obsolete.html
/usr/share/doc/qt6/qtdbus/qdbusconnectioninterface.html
/usr/share/doc/qt6/qtdbus/qdbuscontext-members.html
/usr/share/doc/qt6/qtdbus/qdbuscontext.html
/usr/share/doc/qt6/qtdbus/qdbusdeclaringsignals.html
/usr/share/doc/qt6/qtdbus/qdbusdeclaringslots.html
/usr/share/doc/qt6/qtdbus/qdbuserror-members.html
/usr/share/doc/qt6/qtdbus/qdbuserror.html
/usr/share/doc/qt6/qtdbus/qdbusinterface-members.html
/usr/share/doc/qt6/qtdbus/qdbusinterface.html
/usr/share/doc/qt6/qtdbus/qdbusmessage-members.html
/usr/share/doc/qt6/qtdbus/qdbusmessage.html
/usr/share/doc/qt6/qtdbus/qdbusobjectpath-members.html
/usr/share/doc/qt6/qtdbus/qdbusobjectpath.html
/usr/share/doc/qt6/qtdbus/qdbuspendingcall-members.html
/usr/share/doc/qt6/qtdbus/qdbuspendingcall.html
/usr/share/doc/qt6/qtdbus/qdbuspendingcallwatcher-members.html
/usr/share/doc/qt6/qtdbus/qdbuspendingcallwatcher.html
/usr/share/doc/qt6/qtdbus/qdbuspendingreply-members.html
/usr/share/doc/qt6/qtdbus/qdbuspendingreply.html
/usr/share/doc/qt6/qtdbus/qdbusreply-members.html
/usr/share/doc/qt6/qtdbus/qdbusreply.html
/usr/share/doc/qt6/qtdbus/qdbusserver-members.html
/usr/share/doc/qt6/qtdbus/qdbusserver.html
/usr/share/doc/qt6/qtdbus/qdbusservicewatcher-members.html
/usr/share/doc/qt6/qtdbus/qdbusservicewatcher.html
/usr/share/doc/qt6/qtdbus/qdbussignature-members.html
/usr/share/doc/qt6/qtdbus/qdbussignature.html
/usr/share/doc/qt6/qtdbus/qdbustypesystem.html
/usr/share/doc/qt6/qtdbus/qdbusunixfiledescriptor-members.html
/usr/share/doc/qt6/qtdbus/qdbusunixfiledescriptor.html
/usr/share/doc/qt6/qtdbus/qdbusvariant-members.html
/usr/share/doc/qt6/qtdbus/qdbusvariant.html
/usr/share/doc/qt6/qtdbus/qdbusviewer.html
/usr/share/doc/qt6/qtdbus/qdbusvirtualobject-members.html
/usr/share/doc/qt6/qtdbus/qdbusvirtualobject.html
/usr/share/doc/qt6/qtdbus/qdbusxml2cpp.html
/usr/share/doc/qt6/qtdbus/qtdbus-attribution-libdbus-1-headers.html
/usr/share/doc/qt6/qtdbus/qtdbus-chat-example.html
/usr/share/doc/qt6/qtdbus/qtdbus-cmake-qt-add-dbus-adaptor.html
/usr/share/doc/qt6/qtdbus/qtdbus-cmake-qt-add-dbus-interface.html
/usr/share/doc/qt6/qtdbus/qtdbus-cmake-qt-add-dbus-interfaces.html
/usr/share/doc/qt6/qtdbus/qtdbus-cmake-qt-generate-dbus-interface.html
/usr/share/doc/qt6/qtdbus/qtdbus-complexpingpong-example.html
/usr/share/doc/qt6/qtdbus/qtdbus-index.html
/usr/share/doc/qt6/qtdbus/qtdbus-module.html
/usr/share/doc/qt6/qtdbus/qtdbus-overview.html
/usr/share/doc/qt6/qtdbus/qtdbus-pingpong-example.html
/usr/share/doc/qt6/qtdbus/qtdbus-remotecontrolledcar-example.html
/usr/share/doc/qt6/qtdbus/qtdbus.index
/usr/share/doc/qt6/qtdbus/qtdbus.qhp
/usr/share/doc/qt6/qtdbus/qtdbus.qhp.sha1
/usr/share/doc/qt6/qtdbus/style
/usr/share/doc/qt6/qtdbus/style/offline-dark.css
/usr/share/doc/qt6/qtdbus/style/offline-simple.css
/usr/share/doc/qt6/qtdbus/style/offline.css
/usr/share/doc/qt6/qtdbus/usingadaptors.html
/usr/share/doc/qt6/qtdesigner/designer-buddy-mode.html
/usr/share/doc/qt6/qtdesigner/designer-connection-mode.html
/usr/share/doc/qt6/qtdesigner/designer-creating-custom-widgets-extensions.html
/usr/share/doc/qt6/qtdesigner/designer-creating-custom-widgets.html
/usr/share/doc/qt6/qtdesigner/designer-creating-mainwindows.html
/usr/share/doc/qt6/qtdesigner/designer-customizing-forms.html
/usr/share/doc/qt6/qtdesigner/designer-editing-mode.html
/usr/share/doc/qt6/qtdesigner/designer-layouts.html
/usr/share/doc/qt6/qtdesigner/designer-preview.html
/usr/share/doc/qt6/qtdesigner/designer-quick-start.html
/usr/share/doc/qt6/qtdesigner/designer-resources.html
/usr/share/doc/qt6/qtdesigner/designer-stylesheet.html
/usr/share/doc/qt6/qtdesigner/designer-tab-order.html
/usr/share/doc/qt6/qtdesigner/designer-to-know.html
/usr/share/doc/qt6/qtdesigner/designer-ui-file-format.html
/usr/share/doc/qt6/qtdesigner/designer-using-a-ui-file-python.html
/usr/share/doc/qt6/qtdesigner/designer-using-a-ui-file.html
/usr/share/doc/qt6/qtdesigner/designer-using-containers.html
/usr/share/doc/qt6/qtdesigner/designer-using-custom-widgets.html
/usr/share/doc/qt6/qtdesigner/designer-widget-mode.html
/usr/share/doc/qt6/qtdesigner/examples-designer.html
/usr/share/doc/qt6/qtdesigner/examples-manifest.xml
/usr/share/doc/qt6/qtdesigner/images
/usr/share/doc/qt6/qtdesigner/images/addressbook-tutorial-part3-labeled-layout.png
/usr/share/doc/qt6/qtdesigner/images/arrow_bc.png
/usr/share/doc/qt6/qtdesigner/images/bgrContent.png
/usr/share/doc/qt6/qtdesigner/images/btn_next.png
/usr/share/doc/qt6/qtdesigner/images/btn_prev.png
/usr/share/doc/qt6/qtdesigner/images/bullet_dn.png
/usr/share/doc/qt6/qtdesigner/images/bullet_sq.png
/usr/share/doc/qt6/qtdesigner/images/calculatorbuilder-example.webp
/usr/share/doc/qt6/qtdesigner/images/calculatorform-example.webp
/usr/share/doc/qt6/qtdesigner/images/containerextension-example.webp
/usr/share/doc/qt6/qtdesigner/images/customwidgetplugin-example.webp
/usr/share/doc/qt6/qtdesigner/images/designer-action-editor.png
/usr/share/doc/qt6/qtdesigner/images/designer-add-files-button.png
/usr/share/doc/qt6/qtdesigner/images/designer-add-resource-entry-button.png
/usr/share/doc/qt6/qtdesigner/images/designer-adding-dockwidget.png
/usr/share/doc/qt6/qtdesigner/images/designer-adding-menu-action.png
/usr/share/doc/qt6/qtdesigner/images/designer-adding-toolbar-action.png
/usr/share/doc/qt6/qtdesigner/images/designer-buddy-making.png
/usr/share/doc/qt6/qtdesigner/images/designer-buddy-mode.png
/usr/share/doc/qt6/qtdesigner/images/designer-buddy-tool.png
/usr/share/doc/qt6/qtdesigner/images/designer-choosing-form.png
/usr/share/doc/qt6/qtdesigner/images/designer-code-viewer.png
/usr/share/doc/qt6/qtdesigner/images/designer-connection-dialog.png
/usr/share/doc/qt6/qtdesigner/images/designer-connection-editing.png
/usr/share/doc/qt6/qtdesigner/images/designer-connection-editor.png
/usr/share/doc/qt6/qtdesigner/images/designer-connection-highlight.png
/usr/share/doc/qt6/qtdesigner/images/designer-connection-making.png
/usr/share/doc/qt6/qtdesigner/images/designer-connection-mode.png
/usr/share/doc/qt6/qtdesigner/images/designer-connection-to-form.png
/usr/share/doc/qt6/qtdesigner/images/designer-connection-tool.png
/usr/share/doc/qt6/qtdesigner/images/designer-containers-dockwidget.png
/usr/share/doc/qt6/qtdesigner/images/designer-containers-frame.png
/usr/share/doc/qt6/qtdesigner/images/designer-containers-groupbox.png
/usr/share/doc/qt6/qtdesigner/images/designer-containers-stackedwidget.png
/usr/share/doc/qt6/qtdesigner/images/designer-containers-tabwidget.png
/usr/share/doc/qt6/qtdesigner/images/designer-containers-toolbox.png
/usr/share/doc/qt6/qtdesigner/images/designer-creating-menu-entry1.png
/usr/share/doc/qt6/qtdesigner/images/designer-creating-menu-entry2.png
/usr/share/doc/qt6/qtdesigner/images/designer-creating-menu-entry3.png
/usr/share/doc/qt6/qtdesigner/images/designer-creating-menu-entry4.png
/usr/share/doc/qt6/qtdesigner/images/designer-creating-menu1.png
/usr/share/doc/qt6/qtdesigner/images/designer-creating-menu2.png
/usr/share/doc/qt6/qtdesigner/images/designer-creating-menu3.png
/usr/share/doc/qt6/qtdesigner/images/designer-creating-menu4.png
/usr/share/doc/qt6/qtdesigner/images/designer-creating-toolbar.png
/usr/share/doc/qt6/qtdesigner/images/designer-dialog-preview.png
/usr/share/doc/qt6/qtdesigner/images/designer-dragging-onto-form.png
/usr/share/doc/qt6/qtdesigner/images/designer-edit-resource.png
/usr/share/doc/qt6/qtdesigner/images/designer-edit-resources-button.png
/usr/share/doc/qt6/qtdesigner/images/designer-editing-mode.png
/usr/share/doc/qt6/qtdesigner/images/designer-english-dialog.png
/usr/share/doc/qt6/qtdesigner/images/designer-file-menu.png
/usr/share/doc/qt6/qtdesigner/images/designer-form-layout-cleanlooks.png
/usr/share/doc/qt6/qtdesigner/images/designer-form-layout-macintosh.png
/usr/share/doc/qt6/qtdesigner/images/designer-form-layout-windowsXP.png
/usr/share/doc/qt6/qtdesigner/images/designer-form-layout.png
/usr/share/doc/qt6/qtdesigner/images/designer-form-layoutfunction.png
/usr/share/doc/qt6/qtdesigner/images/designer-form-settings.png
/usr/share/doc/qt6/qtdesigner/images/designer-form-viewcode.png
/usr/share/doc/qt6/qtdesigner/images/designer-french-dialog.png
/usr/share/doc/qt6/qtdesigner/images/designer-layout-inserting.png
/usr/share/doc/qt6/qtdesigner/images/designer-main-window.png
/usr/share/doc/qt6/qtdesigner/images/designer-manual-containerextension.png
/usr/share/doc/qt6/qtdesigner/images/designer-manual-membersheetextension.png
/usr/share/doc/qt6/qtdesigner/images/designer-manual-propertysheetextension.png
/usr/share/doc/qt6/qtdesigner/images/designer-manual-taskmenuextension.png
/usr/share/doc/qt6/qtdesigner/images/designer-multiple-screenshot.png
/usr/share/doc/qt6/qtdesigner/images/designer-object-inspector.png
/usr/share/doc/qt6/qtdesigner/images/designer-preview-deviceskin-selection.png
/usr/share/doc/qt6/qtdesigner/images/designer-preview-style-selection.png
/usr/share/doc/qt6/qtdesigner/images/designer-preview-style.png
/usr/share/doc/qt6/qtdesigner/images/designer-preview-stylesheet.png
/usr/share/doc/qt6/qtdesigner/images/designer-promoting-widgets.png
/usr/share/doc/qt6/qtdesigner/images/designer-property-editor-add-dynamic.png
/usr/share/doc/qt6/qtdesigner/images/designer-property-editor-configure.png
/usr/share/doc/qt6/qtdesigner/images/designer-property-editor-remove-dynamic.png
/usr/share/doc/qt6/qtdesigner/images/designer-property-editor-toolbar.png
/usr/share/doc/qt6/qtdesigner/images/designer-property-editor.png
/usr/share/doc/qt6/qtdesigner/images/designer-reload-resources-button.png
/usr/share/doc/qt6/qtdesigner/images/designer-remove-resource-entry-button.png
/usr/share/doc/qt6/qtdesigner/images/designer-removing-toolbar-action.png
/usr/share/doc/qt6/qtdesigner/images/designer-resource-browser.png
/usr/share/doc/qt6/qtdesigner/images/designer-resource-selector.png
/usr/share/doc/qt6/qtdesigner/images/designer-resources-editing.png
/usr/share/doc/qt6/qtdesigner/images/designer-resources-using.png
/usr/share/doc/qt6/qtdesigner/images/designer-screenshot.png
/usr/share/doc/qt6/qtdesigner/images/designer-selecting-widget.png
/usr/share/doc/qt6/qtdesigner/images/designer-set-layout.png
/usr/share/doc/qt6/qtdesigner/images/designer-set-layout2.png
/usr/share/doc/qt6/qtdesigner/images/designer-splitter-layout.png
/usr/share/doc/qt6/qtdesigner/images/designer-stylesheet-options.png
/usr/share/doc/qt6/qtdesigner/images/designer-stylesheet-usage.png
/usr/share/doc/qt6/qtdesigner/images/designer-tab-order-mode.png
/usr/share/doc/qt6/qtdesigner/images/designer-tab-order-tool.png
/usr/share/doc/qt6/qtdesigner/images/designer-widget-box.png
/usr/share/doc/qt6/qtdesigner/images/designer-widget-morph.png
/usr/share/doc/qt6/qtdesigner/images/designer-widget-tool.png
/usr/share/doc/qt6/qtdesigner/images/directapproach-calculatorform.png
/usr/share/doc/qt6/qtdesigner/images/home.png
/usr/share/doc/qt6/qtdesigner/images/ico_note.png
/usr/share/doc/qt6/qtdesigner/images/ico_note_attention.png
/usr/share/doc/qt6/qtdesigner/images/ico_out.png
/usr/share/doc/qt6/qtdesigner/images/logo.png
/usr/share/doc/qt6/qtdesigner/images/qtdesignerextensions.png
/usr/share/doc/qt6/qtdesigner/images/qtdesignerscreenshot.png
/usr/share/doc/qt6/qtdesigner/images/rgbController-arrangement.png
/usr/share/doc/qt6/qtdesigner/images/rgbController-configure-connection1.png
/usr/share/doc/qt6/qtdesigner/images/rgbController-configure-connection2.png
/usr/share/doc/qt6/qtdesigner/images/rgbController-final-layout.png
/usr/share/doc/qt6/qtdesigner/images/rgbController-form-gridLayout.png
/usr/share/doc/qt6/qtdesigner/images/rgbController-no-toplevel-layout.png
/usr/share/doc/qt6/qtdesigner/images/rgbController-property-editing.png
/usr/share/doc/qt6/qtdesigner/images/rgbController-screenshot.png
/usr/share/doc/qt6/qtdesigner/images/rgbController-selectForLayout.png
/usr/share/doc/qt6/qtdesigner/images/rgbController-signalsAndSlots.png
/usr/share/doc/qt6/qtdesigner/images/taskmenuextension-dialog.webp
/usr/share/doc/qt6/qtdesigner/images/taskmenuextension-example.webp
/usr/share/doc/qt6/qtdesigner/images/taskmenuextension-menu.webp
/usr/share/doc/qt6/qtdesigner/qabstractextensionfactory-members.html
/usr/share/doc/qt6/qtdesigner/qabstractextensionfactory.html
/usr/share/doc/qt6/qtdesigner/qabstractextensionmanager-members.html
/usr/share/doc/qt6/qtdesigner/qabstractextensionmanager.html
/usr/share/doc/qt6/qtdesigner/qabstractformbuilder-members.html
/usr/share/doc/qt6/qtdesigner/qabstractformbuilder.html
/usr/share/doc/qt6/qtdesigner/qdesigneractioneditorinterface-members.html
/usr/share/doc/qt6/qtdesigner/qdesigneractioneditorinterface.html
/usr/share/doc/qt6/qtdesigner/qdesignercontainerextension-members.html
/usr/share/doc/qt6/qtdesigner/qdesignercontainerextension.html
/usr/share/doc/qt6/qtdesigner/qdesignercustomwidgetcollectioninterface-members.html
/usr/share/doc/qt6/qtdesigner/qdesignercustomwidgetcollectioninterface.html
/usr/share/doc/qt6/qtdesigner/qdesignercustomwidgetinterface-members.html
/usr/share/doc/qt6/qtdesigner/qdesignercustomwidgetinterface.html
/usr/share/doc/qt6/qtdesigner/qdesignerdynamicpropertysheetextension-members.html
/usr/share/doc/qt6/qtdesigner/qdesignerdynamicpropertysheetextension.html
/usr/share/doc/qt6/qtdesigner/qdesignerformeditorinterface-members.html
/usr/share/doc/qt6/qtdesigner/qdesignerformeditorinterface.html
/usr/share/doc/qt6/qtdesigner/qdesignerformwindowcursorinterface-members.html
/usr/share/doc/qt6/qtdesigner/qdesignerformwindowcursorinterface.html
/usr/share/doc/qt6/qtdesigner/qdesignerformwindowinterface-members.html
/usr/share/doc/qt6/qtdesigner/qdesignerformwindowinterface.html
/usr/share/doc/qt6/qtdesigner/qdesignerformwindowmanagerinterface-members.html
/usr/share/doc/qt6/qtdesigner/qdesignerformwindowmanagerinterface-obsolete.html
/usr/share/doc/qt6/qtdesigner/qdesignerformwindowmanagerinterface.html
/usr/share/doc/qt6/qtdesigner/qdesignermembersheetextension-members.html
/usr/share/doc/qt6/qtdesigner/qdesignermembersheetextension.html
/usr/share/doc/qt6/qtdesigner/qdesignerobjectinspectorinterface-members.html
/usr/share/doc/qt6/qtdesigner/qdesignerobjectinspectorinterface.html
/usr/share/doc/qt6/qtdesigner/qdesignerpropertyeditorinterface-members.html
/usr/share/doc/qt6/qtdesigner/qdesignerpropertyeditorinterface.html
/usr/share/doc/qt6/qtdesigner/qdesignerpropertysheetextension-members.html
/usr/share/doc/qt6/qtdesigner/qdesignerpropertysheetextension.html
/usr/share/doc/qt6/qtdesigner/qdesignertaskmenuextension-members.html
/usr/share/doc/qt6/qtdesigner/qdesignertaskmenuextension.html
/usr/share/doc/qt6/qtdesigner/qdesignerwidgetboxinterface-members.html
/usr/share/doc/qt6/qtdesigner/qdesignerwidgetboxinterface.html
/usr/share/doc/qt6/qtdesigner/qextensionfactory-members.html
/usr/share/doc/qt6/qtdesigner/qextensionfactory.html
/usr/share/doc/qt6/qtdesigner/qextensionmanager-members.html
/usr/share/doc/qt6/qtdesigner/qextensionmanager.html
/usr/share/doc/qt6/qtdesigner/qformbuilder-members.html
/usr/share/doc/qt6/qtdesigner/qformbuilder.html
/usr/share/doc/qt6/qtdesigner/qtdesigner-calculatorbuilder-example.html
/usr/share/doc/qt6/qtdesigner/qtdesigner-calculatorform-example.html
/usr/share/doc/qt6/qtdesigner/qtdesigner-calculatorform-mi-example.html
/usr/share/doc/qt6/qtdesigner/qtdesigner-components.html
/usr/share/doc/qt6/qtdesigner/qtdesigner-containerextension-example.html
/usr/share/doc/qt6/qtdesigner/qtdesigner-customwidgetplugin-example.html
/usr/share/doc/qt6/qtdesigner/qtdesigner-index.html
/usr/share/doc/qt6/qtdesigner/qtdesigner-manual.html
/usr/share/doc/qt6/qtdesigner/qtdesigner-module.html
/usr/share/doc/qt6/qtdesigner/qtdesigner-taskmenuextension-example.html
/usr/share/doc/qt6/qtdesigner/qtdesigner.index
/usr/share/doc/qt6/qtdesigner/qtdesigner.qhp
/usr/share/doc/qt6/qtdesigner/qtdesigner.qhp.sha1
/usr/share/doc/qt6/qtdesigner/style
/usr/share/doc/qt6/qtdesigner/style/offline-dark.css
/usr/share/doc/qt6/qtdesigner/style/offline-simple.css
/usr/share/doc/qt6/qtdesigner/style/offline.css
/usr/share/doc/qt6/qtdistancefieldgenerator/images
/usr/share/doc/qt6/qtdistancefieldgenerator/images/arrow_bc.png
/usr/share/doc/qt6/qtdistancefieldgenerator/images/bgrContent.png
/usr/share/doc/qt6/qtdistancefieldgenerator/images/btn_next.png
/usr/share/doc/qt6/qtdistancefieldgenerator/images/btn_prev.png
/usr/share/doc/qt6/qtdistancefieldgenerator/images/bullet_dn.png
/usr/share/doc/qt6/qtdistancefieldgenerator/images/bullet_sq.png
/usr/share/doc/qt6/qtdistancefieldgenerator/images/distancefieldgenerator.png
/usr/share/doc/qt6/qtdistancefieldgenerator/images/home.png
/usr/share/doc/qt6/qtdistancefieldgenerator/images/ico_note.png
/usr/share/doc/qt6/qtdistancefieldgenerator/images/ico_note_attention.png
/usr/share/doc/qt6/qtdistancefieldgenerator/images/ico_out.png
/usr/share/doc/qt6/qtdistancefieldgenerator/images/logo.png
/usr/share/doc/qt6/qtdistancefieldgenerator/qtdistancefieldgenerator-index.html
/usr/share/doc/qt6/qtdistancefieldgenerator/qtdistancefieldgenerator.index
/usr/share/doc/qt6/qtdistancefieldgenerator/qtdistancefieldgenerator.qhp
/usr/share/doc/qt6/qtdistancefieldgenerator/qtdistancefieldgenerator.qhp.sha1
/usr/share/doc/qt6/qtdistancefieldgenerator/style
/usr/share/doc/qt6/qtdistancefieldgenerator/style/offline-dark.css
/usr/share/doc/qt6/qtdistancefieldgenerator/style/offline-simple.css
/usr/share/doc/qt6/qtdistancefieldgenerator/style/offline.css
/usr/share/doc/qt6/qtdoc/accessibility.html
/usr/share/doc/qt6/qtdoc/accessible-qtquick.html
/usr/share/doc/qt6/qtdoc/accessible-qwidget.html
/usr/share/doc/qt6/qtdoc/accessible.html
/usr/share/doc/qt6/qtdoc/activeqt-idc.html
/usr/share/doc/qt6/qtdoc/activeqt-testcon.html
/usr/share/doc/qt6/qtdoc/android-3rdparty-libs.html
/usr/share/doc/qt6/qtdoc/android-build-environment-variables.html
/usr/share/doc/qt6/qtdoc/android-building-user-projects.html
/usr/share/doc/qt6/qtdoc/android-building.html
/usr/share/doc/qt6/qtdoc/android-emojis.html
/usr/share/doc/qt6/qtdoc/android-environment-variables.html
/usr/share/doc/qt6/qtdoc/android-getting-started.html
/usr/share/doc/qt6/qtdoc/android-how-it-works.html
/usr/share/doc/qt6/qtdoc/android-openssl-support.html
/usr/share/doc/qt6/qtdoc/android-platform-notes.html
/usr/share/doc/qt6/qtdoc/android-publishing-to-googleplay.html
/usr/share/doc/qt6/qtdoc/android-runtime-licensing-notes.html
/usr/share/doc/qt6/qtdoc/android-services.html
/usr/share/doc/qt6/qtdoc/android.html
/usr/share/doc/qt6/qtdoc/annotated.html
/usr/share/doc/qt6/qtdoc/appicon.html
/usr/share/doc/qt6/qtdoc/best-practices.html
/usr/share/doc/qt6/qtdoc/bughowto.html
/usr/share/doc/qt6/qtdoc/build-sources.html
/usr/share/doc/qt6/qtdoc/building-qt-for-qnx.html
/usr/share/doc/qt6/qtdoc/classes.html
/usr/share/doc/qt6/qtdoc/classesandfunctions.html
/usr/share/doc/qt6/qtdoc/configure-linux-device.html
/usr/share/doc/qt6/qtdoc/configure-options.html
/usr/share/doc/qt6/qtdoc/create-your-first-applications.html
/usr/share/doc/qt6/qtdoc/debug.html
/usr/share/doc/qt6/qtdoc/deployment-android.html
/usr/share/doc/qt6/qtdoc/deployment-plugins.html
/usr/share/doc/qt6/qtdoc/deployment.html
/usr/share/doc/qt6/qtdoc/desktop-integration.html
/usr/share/doc/qt6/qtdoc/embedded-linux.html
/usr/share/doc/qt6/qtdoc/examples-animation.html
/usr/share/doc/qt6/qtdoc/examples-draganddrop.html
/usr/share/doc/qt6/qtdoc/examples-gestures.html
/usr/share/doc/qt6/qtdoc/examples-ios.html
/usr/share/doc/qt6/qtdoc/examples-ipc.html
/usr/share/doc/qt6/qtdoc/examples-layouts.html
/usr/share/doc/qt6/qtdoc/examples-license.html
/usr/share/doc/qt6/qtdoc/examples-manifest.xml
/usr/share/doc/qt6/qtdoc/examples-sql.html
/usr/share/doc/qt6/qtdoc/examples-threadandconcurrent.html
/usr/share/doc/qt6/qtdoc/examples-widgets-tools.html
/usr/share/doc/qt6/qtdoc/examples-xml.html
/usr/share/doc/qt6/qtdoc/exceptionsafety.html
/usr/share/doc/qt6/qtdoc/explore-qt.html
/usr/share/doc/qt6/qtdoc/extras-changes-qt6.html
/usr/share/doc/qt6/qtdoc/fdl.html
/usr/share/doc/qt6/qtdoc/functions.html
/usr/share/doc/qt6/qtdoc/get-and-install-qt-cli.html
/usr/share/doc/qt6/qtdoc/get-and-install-qt.html
/usr/share/doc/qt6/qtdoc/gettingstarted.html
/usr/share/doc/qt6/qtdoc/gpl.html
/usr/share/doc/qt6/qtdoc/groups.html
/usr/share/doc/qt6/qtdoc/hierarchy.html
/usr/share/doc/qt6/qtdoc/highdpi.html
/usr/share/doc/qt6/qtdoc/i18n-plural-rules.html
/usr/share/doc/qt6/qtdoc/i18n-source-translation.html
/usr/share/doc/qt6/qtdoc/images
/usr/share/doc/qt6/qtdoc/images/5OiIqFTjUZI.jpg
/usr/share/doc/qt6/qtdoc/images/BenchmarkDemoQt6.png
/usr/share/doc/qt6/qtdoc/images/CustomStyle_Dark.png
/usr/share/doc/qt6/qtdoc/images/CustomStyle_Light.png
/usr/share/doc/qt6/qtdoc/images/FX_Material_Showroom.png
/usr/share/doc/qt6/qtdoc/images/Material_Dark.png
/usr/share/doc/qt6/qtdoc/images/Material_Light.png
/usr/share/doc/qt6/qtdoc/images/Settings_CustomStyle.png
/usr/share/doc/qt6/qtdoc/images/Settings_Material.png
/usr/share/doc/qt6/qtdoc/images/Settings_iOS.png
/usr/share/doc/qt6/qtdoc/images/accessibleobjecttree.png
/usr/share/doc/qt6/qtdoc/images/addalarms.png
/usr/share/doc/qt6/qtdoc/images/alarms2.png
/usr/share/doc/qt6/qtdoc/images/alarms3.png
/usr/share/doc/qt6/qtdoc/images/android-single-abis.png
/usr/share/doc/qt6/qtdoc/images/android-source-folder.png
/usr/share/doc/qt6/qtdoc/images/animation-examples.png
/usr/share/doc/qt6/qtdoc/images/applicationwindow.png
/usr/share/doc/qt6/qtdoc/images/arrow_bc.png
/usr/share/doc/qt6/qtdoc/images/bgrContent.png
/usr/share/doc/qt6/qtdoc/images/btn_next.png
/usr/share/doc/qt6/qtdoc/images/btn_prev.png
/usr/share/doc/qt6/qtdoc/images/bullet_dn.png
/usr/share/doc/qt6/qtdoc/images/bullet_sq.png
/usr/share/doc/qt6/qtdoc/images/coffee_machine_modify.png
/usr/share/doc/qt6/qtdoc/images/coffee_machine_overview.png
/usr/share/doc/qt6/qtdoc/images/coffee_machine_selection.png
/usr/share/doc/qt6/qtdoc/images/colorpalette_editing.png
/usr/share/doc/qt6/qtdoc/images/colorpalette_listing.png
/usr/share/doc/qt6/qtdoc/images/colorpalette_urlselection.png
/usr/share/doc/qt6/qtdoc/images/controls.png
/usr/share/doc/qt6/qtdoc/images/deployment-mac-application.png
/usr/share/doc/qt6/qtdoc/images/deployment-mac-bundlestructure.png
/usr/share/doc/qt6/qtdoc/images/desktop_dark.png
/usr/share/doc/qt6/qtdoc/images/desktop_light.png
/usr/share/doc/qt6/qtdoc/images/detailscreen.png
/usr/share/doc/qt6/qtdoc/images/dice-screenshot.webp
/usr/share/doc/qt6/qtdoc/images/documentviewer_open.png
/usr/share/doc/qt6/qtdoc/images/dprgadget.png
/usr/share/doc/qt6/qtdoc/images/dynamic-loaded-pro.png
/usr/share/doc/qt6/qtdoc/images/dynamic-pro.png
/usr/share/doc/qt6/qtdoc/images/fastboot-mode.png
/usr/share/doc/qt6/qtdoc/images/front-coding.png
/usr/share/doc/qt6/qtdoc/images/front-ui.png
/usr/share/doc/qt6/qtdoc/images/home.png
/usr/share/doc/qt6/qtdoc/images/iOS_Dark.png
/usr/share/doc/qt6/qtdoc/images/iOS_Light.png
/usr/share/doc/qt6/qtdoc/images/ico_note.png
/usr/share/doc/qt6/qtdoc/images/ico_note_attention.png
/usr/share/doc/qt6/qtdoc/images/ico_out.png
/usr/share/doc/qt6/qtdoc/images/icon_QtCreator_78x78px.png
/usr/share/doc/qt6/qtdoc/images/icon_Qt_78x78px.png
/usr/share/doc/qt6/qtdoc/images/icon_Tools.png
/usr/share/doc/qt6/qtdoc/images/integrity-os.png
/usr/share/doc/qt6/qtdoc/images/layout-examples.png
/usr/share/doc/qt6/qtdoc/images/logo.png
/usr/share/doc/qt6/qtdoc/images/mainscreen.png
/usr/share/doc/qt6/qtdoc/images/maintenancetool.png
/usr/share/doc/qt6/qtdoc/images/mediaplayer.png
/usr/share/doc/qt6/qtdoc/images/mobile_dark.png
/usr/share/doc/qt6/qtdoc/images/mobile_light.png
/usr/share/doc/qt6/qtdoc/images/nmvurCcsWos.jpg
/usr/share/doc/qt6/qtdoc/images/ok.png
/usr/share/doc/qt6/qtdoc/images/open-project.png
/usr/share/doc/qt6/qtdoc/images/piemenu.gif
/usr/share/doc/qt6/qtdoc/images/project-structure.png
/usr/share/doc/qt6/qtdoc/images/project_structure.png
/usr/share/doc/qt6/qtdoc/images/qml-application.png
/usr/share/doc/qt6/qtdoc/images/qml-extending-types.gif
/usr/share/doc/qt6/qtdoc/images/qml-uses-animation.png
/usr/share/doc/qt6/qtdoc/images/qml-uses-integratingjs.png
/usr/share/doc/qt6/qtdoc/images/qml-uses-layouts-anchors.png
/usr/share/doc/qt6/qtdoc/images/qml-uses-layouts-direct.png
/usr/share/doc/qt6/qtdoc/images/qml-uses-layouts-positioners.png
/usr/share/doc/qt6/qtdoc/images/qml-uses-text.png
/usr/share/doc/qt6/qtdoc/images/qml-uses-visual-opacity.png
/usr/share/doc/qt6/qtdoc/images/qml-uses-visual-rectangles.png
/usr/share/doc/qt6/qtdoc/images/qml-uses-visual-transforms.png
/usr/share/doc/qt6/qtdoc/images/qt-codesample.png
/usr/share/doc/qt6/qtdoc/images/qt-edu-apply.png
/usr/share/doc/qt6/qtdoc/images/qt-edu-browse-qbsp.png
/usr/share/doc/qt6/qtdoc/images/qt-edu-contribute.png
/usr/share/doc/qt6/qtdoc/images/qt-edu-creator-open.png
/usr/share/doc/qt6/qtdoc/images/qt-edu-creator-welcome.png
/usr/share/doc/qt6/qtdoc/images/qt-edu-custominstallation.png
/usr/share/doc/qt6/qtdoc/images/qt-edu-design-studio-open.png
/usr/share/doc/qt6/qtdoc/images/qt-edu-design-studio-welcome.png
/usr/share/doc/qt6/qtdoc/images/qt-edu-download.png
/usr/share/doc/qt6/qtdoc/images/qt-edu-install-design-studio.png
/usr/share/doc/qt6/qtdoc/images/qt-edu-install-finish-design-studio.png
/usr/share/doc/qt6/qtdoc/images/qt-edu-install-finish-qt.png
/usr/share/doc/qt6/qtdoc/images/qt-edu-install-qt.png
/usr/share/doc/qt6/qtdoc/images/qt-edu-install-xcode.png
/usr/share/doc/qt6/qtdoc/images/qt-edu-license-agreement.png
/usr/share/doc/qt6/qtdoc/images/qt-edu-login.png
/usr/share/doc/qt6/qtdoc/images/qt-edu-maintenancetool.png
/usr/share/doc/qt6/qtdoc/images/qt-edu-password.png
/usr/share/doc/qt6/qtdoc/images/qt-edu-qbsp-download.png
/usr/share/doc/qt6/qtdoc/images/qt-edu-qbsp.png
/usr/share/doc/qt6/qtdoc/images/qt-embedded-fontfeatures.png
/usr/share/doc/qt6/qtdoc/images/qt_android_architecture.png
/usr/share/doc/qt6/qtdoc/images/qtcreator-clazy-checks-for-porting-to-qt6.png
/usr/share/doc/qt6/qtdoc/images/qtcreator-create-templates.png
/usr/share/doc/qt6/qtdoc/images/qtcreator-qt-quick-editors.png
/usr/share/doc/qt6/qtdoc/images/qtdesigner.png
/usr/share/doc/qt6/qtdoc/images/qtdesignstudio-examples.png
/usr/share/doc/qt6/qtdoc/images/qtdesignstudio.png
/usr/share/doc/qt6/qtdoc/images/qthangman-example.png
/usr/share/doc/qt6/qtdoc/images/qthangman-store-example.png
/usr/share/doc/qt6/qtdoc/images/qtinstallercomponents.png
/usr/share/doc/qt6/qtdoc/images/qtquick-demo-calqlatr.png
/usr/share/doc/qt6/qtdoc/images/qtquick-demo-clocks-small.png
/usr/share/doc/qt6/qtdoc/images/qtquick-demo-photosurface-small.png
/usr/share/doc/qt6/qtdoc/images/qtquick-demo-rssnews-small.png
/usr/share/doc/qt6/qtdoc/images/qtquick-demo-samegame-med-1.png
/usr/share/doc/qt6/qtdoc/images/qtquick-demo-samegame-med-2.png
/usr/share/doc/qt6/qtdoc/images/qtquick-demo-stocqt.png
/usr/share/doc/qt6/qtdoc/images/qtquick3D.png
/usr/share/doc/qt6/qtdoc/images/rhiarch.png
/usr/share/doc/qt6/qtdoc/images/robotarm-example.png
/usr/share/doc/qt6/qtdoc/images/sa8155-target.png
/usr/share/doc/qt6/qtdoc/images/sa8155p.png
/usr/share/doc/qt6/qtdoc/images/scalability-gridlayout.png
/usr/share/doc/qt6/qtdoc/images/session.png
/usr/share/doc/qt6/qtdoc/images/small_dark.png
/usr/share/doc/qt6/qtdoc/images/small_light.png
/usr/share/doc/qt6/qtdoc/images/sql-examples.png
/usr/share/doc/qt6/qtdoc/images/thread-examples.png
/usr/share/doc/qt6/qtdoc/images/threadsandobjects.png
/usr/share/doc/qt6/qtdoc/images/threadvisual-example.png
/usr/share/doc/qt6/qtdoc/images/tool-examples.png
/usr/share/doc/qt6/qtdoc/images/txtviewer_screenshot.png
/usr/share/doc/qt6/qtdoc/images/wayland-multi-process.png
/usr/share/doc/qt6/qtdoc/images/wayland-single-process-develop.png
/usr/share/doc/qt6/qtdoc/images/wayland-single-process-eglfs.png
/usr/share/doc/qt6/qtdoc/images/wiring1.png
/usr/share/doc/qt6/qtdoc/images/wiring2.png
/usr/share/doc/qt6/qtdoc/images/xNIz78IPBu0.jpg
/usr/share/doc/qt6/qtdoc/images/xml-examples.png
/usr/share/doc/qt6/qtdoc/images/yIv0vO8B7tQ.jpg
/usr/share/doc/qt6/qtdoc/index.html
/usr/share/doc/qt6/qtdoc/inputs-linux-device.html
/usr/share/doc/qt6/qtdoc/install-qt-design-studio.html
/usr/share/doc/qt6/qtdoc/integrity-building-and-flashing-dd-project.html
/usr/share/doc/qt6/qtdoc/integrity-building-monolith.html
/usr/share/doc/qt6/qtdoc/integrity-building-qt-8155p-on-ubuntu.html
/usr/share/doc/qt6/qtdoc/integrity-building-qt-8155p-on-windows.html
/usr/share/doc/qt6/qtdoc/integrity-flash-image-and-run.html
/usr/share/doc/qt6/qtdoc/integrity-installing-dependencies.html
/usr/share/doc/qt6/qtdoc/integrity-linux-monolith.html
/usr/share/doc/qt6/qtdoc/integrity-monolith-project-tutorial.html
/usr/share/doc/qt6/qtdoc/integrity-win-monolith.html
/usr/share/doc/qt6/qtdoc/integrity.html
/usr/share/doc/qt6/qtdoc/internationalization.html
/usr/share/doc/qt6/qtdoc/ios-building-from-source.html
/usr/share/doc/qt6/qtdoc/ios-platform-notes.html
/usr/share/doc/qt6/qtdoc/ios.html
/usr/share/doc/qt6/qtdoc/ipc.html
/usr/share/doc/qt6/qtdoc/known-issues.html
/usr/share/doc/qt6/qtdoc/lgpl.html
/usr/share/doc/qt6/qtdoc/license-changes.html
/usr/share/doc/qt6/qtdoc/licenses-used-in-qt.html
/usr/share/doc/qt6/qtdoc/licensing.html
/usr/share/doc/qt6/qtdoc/linux-building.html
/usr/share/doc/qt6/qtdoc/linux-deployment.html
/usr/share/doc/qt6/qtdoc/linux-issues.html
/usr/share/doc/qt6/qtdoc/linux-requirements.html
/usr/share/doc/qt6/qtdoc/linux.html
/usr/share/doc/qt6/qtdoc/localization.html
/usr/share/doc/qt6/qtdoc/macos-building.html
/usr/share/doc/qt6/qtdoc/macos-deployment.html
/usr/share/doc/qt6/qtdoc/macos-issues.html
/usr/share/doc/qt6/qtdoc/macos.html
/usr/share/doc/qt6/qtdoc/mobiledevelopment.html
/usr/share/doc/qt6/qtdoc/moc.html
/usr/share/doc/qt6/qtdoc/modulechanges.html
/usr/share/doc/qt6/qtdoc/modules-cpp.html
/usr/share/doc/qt6/qtdoc/modules-qml.html
/usr/share/doc/qt6/qtdoc/modules.html
/usr/share/doc/qt6/qtdoc/namespaces.html
/usr/share/doc/qt6/qtdoc/newclasses60.html
/usr/share/doc/qt6/qtdoc/newclasses61.html
/usr/share/doc/qt6/qtdoc/newclasses62.html
/usr/share/doc/qt6/qtdoc/newclasses63.html
/usr/share/doc/qt6/qtdoc/newclasses64.html
/usr/share/doc/qt6/qtdoc/newclasses65.html
/usr/share/doc/qt6/qtdoc/newclasses66.html
/usr/share/doc/qt6/qtdoc/obsoleteclasses.html
/usr/share/doc/qt6/qtdoc/obsoleteqmltypes.html
/usr/share/doc/qt6/qtdoc/overviews-main.html
/usr/share/doc/qt6/qtdoc/overviews.html
/usr/share/doc/qt6/qtdoc/packaging-recommendations.html
/usr/share/doc/qt6/qtdoc/plugins-howto.html
/usr/share/doc/qt6/qtdoc/porting-to-android.html
/usr/share/doc/qt6/qtdoc/porting-to-ios.html
/usr/share/doc/qt6/qtdoc/porting-to-qt6-using-clazy.html
/usr/share/doc/qt6/qtdoc/portingguide.html
/usr/share/doc/qt6/qtdoc/qml-codingconventions.html
/usr/share/doc/qt6/qtdoc/qml-glossary.html
/usr/share/doc/qt6/qtdoc/qmlapplications.html
/usr/share/doc/qt6/qtdoc/qmlfirststeps.html
/usr/share/doc/qt6/qtdoc/qmltypes.html
/usr/share/doc/qt6/qtdoc/qmlvaluetypes.html
/usr/share/doc/qt6/qtdoc/qnx-support.html
/usr/share/doc/qt6/qtdoc/qnx-target-requirements.html
/usr/share/doc/qt6/qtdoc/qnx.html
/usr/share/doc/qt6/qtdoc/qt-activex.html
/usr/share/doc/qt6/qtdoc/qt-attribution-cmake-macros.html
/usr/share/doc/qt6/qtdoc/qt-attribution-llvm.html
/usr/share/doc/qt6/qtdoc/qt-attribution-llvmpipe.html
/usr/share/doc/qt6/qtdoc/qt-conf.html
/usr/share/doc/qt6/qtdoc/qt-debian-packages.html
/usr/share/doc/qt6/qtdoc/qt-edu-for-designers.html
/usr/share/doc/qt6/qtdoc/qt-edu-for-developers.html
/usr/share/doc/qt6/qtdoc/qt-edu-raspberry-pi.html
/usr/share/doc/qt6/qtdoc/qt-edu-resources.html
/usr/share/doc/qt6/qtdoc/qt-embedded-fonts.html
/usr/share/doc/qt6/qtdoc/qt-embedded-kmap2qmap.html
/usr/share/doc/qt6/qtdoc/qt-embedded-makeqpf.html
/usr/share/doc/qt6/qtdoc/qt-for-education.html
/usr/share/doc/qt6/qtdoc/qt-gui-concepts.html
/usr/share/doc/qt6/qtdoc/qt-intro.html
/usr/share/doc/qt6/qtdoc/qt-online-installation.html
/usr/share/doc/qt6/qtdoc/qt6-buildsystem.html
/usr/share/doc/qt6/qtdoc/qtconcurrent-mtexamples.html
/usr/share/doc/qt6/qtdoc/qtconcurrentexamples.html
/usr/share/doc/qt6/qtdoc/qtdoc-attribution-colorpaletteclient.html
/usr/share/doc/qt6/qtdoc/qtdoc-attribution-dice-roundcarpet.html
/usr/share/doc/qt6/qtdoc/qtdoc-attribution-dice-table.html
/usr/share/doc/qt6/qtdoc/qtdoc-attribution-thermostatexample-materialicons.html
/usr/share/doc/qt6/qtdoc/qtdoc-attribution-thermostatexample-phosphoricons.html
/usr/share/doc/qt6/qtdoc/qtdoc-attribution-todolistexample-materialicons.html
/usr/share/doc/qt6/qtdoc/qtdoc-demos-calqlatr-example.html
/usr/share/doc/qt6/qtdoc/qtdoc-demos-clocks-example.html
/usr/share/doc/qt6/qtdoc/qtdoc-demos-coffee-example.html
/usr/share/doc/qt6/qtdoc/qtdoc-demos-colorpaletteclient-example.html
/usr/share/doc/qt6/qtdoc/qtdoc-demos-dice-example.html
/usr/share/doc/qt6/qtdoc/qtdoc-demos-documentviewer-example.html
/usr/share/doc/qt6/qtdoc/qtdoc-demos-documentviewer-plugins-txtviewer-example.html
/usr/share/doc/qt6/qtdoc/qtdoc-demos-fx-material-showroom-example.html
/usr/share/doc/qt6/qtdoc/qtdoc-demos-hangman-example.html
/usr/share/doc/qt6/qtdoc/qtdoc-demos-mediaplayer-example.html
/usr/share/doc/qt6/qtdoc/qtdoc-demos-photosurface-example.html
/usr/share/doc/qt6/qtdoc/qtdoc-demos-robotarm-example.html
/usr/share/doc/qt6/qtdoc/qtdoc-demos-rssnews-example.html
/usr/share/doc/qt6/qtdoc/qtdoc-demos-samegame-example.html
/usr/share/doc/qt6/qtdoc/qtdoc-demos-stocqt-example.html
/usr/share/doc/qt6/qtdoc/qtdoc-demos-thermostat-example.html
/usr/share/doc/qt6/qtdoc/qtdoc-demos-todolist-example.html
/usr/share/doc/qt6/qtdoc/qtdoc-tutorials-alarms-example.html
/usr/share/doc/qt6/qtdoc/qtdoc.index
/usr/share/doc/qt6/qtdoc/qtdoc.qhp
/usr/share/doc/qt6/qtdoc/qtdoc.qhp.sha1
/usr/share/doc/qt6/qtdoc/qtentrypoint.html
/usr/share/doc/qt6/qtdoc/qtexamples.html
/usr/share/doc/qt6/qtdoc/qtexamplesandtutorials.html
/usr/share/doc/qt6/qtdoc/qtlanguages.html
/usr/share/doc/qt6/qtdoc/qtmodules.html
/usr/share/doc/qt6/qtdoc/qtpurchasing-androidclasses.html
/usr/share/doc/qt6/qtdoc/qtpurchasing-appstore.html
/usr/share/doc/qt6/qtdoc/qtpurchasing-baseclasses.html
/usr/share/doc/qt6/qtdoc/qtpurchasing-googleplay.html
/usr/share/doc/qt6/qtdoc/qtpurchasing-iosclasses.html
/usr/share/doc/qt6/qtdoc/qtquick-debugging.html
/usr/share/doc/qt6/qtdoc/qtquick-deployment.html
/usr/share/doc/qt6/qtdoc/qtquick-performance.html
/usr/share/doc/qt6/qtdoc/qtquick-qml-runtime.html
/usr/share/doc/qt6/qtdoc/qtquick-usecase-animations.html
/usr/share/doc/qt6/qtdoc/qtquick-usecase-integratingjs.html
/usr/share/doc/qt6/qtdoc/qtquick-usecase-layouts.html
/usr/share/doc/qt6/qtdoc/qtquick-usecase-styling.html
/usr/share/doc/qt6/qtdoc/qtquick-usecase-text.html
/usr/share/doc/qt6/qtdoc/qtquick-usecase-userinput.html
/usr/share/doc/qt6/qtdoc/qtquick-usecase-visual.html
/usr/share/doc/qt6/qtdoc/qundo.html
/usr/share/doc/qt6/qtdoc/rcc.html
/usr/share/doc/qt6/qtdoc/reference-overview.html
/usr/share/doc/qt6/qtdoc/restoring-geometry.html
/usr/share/doc/qt6/qtdoc/scalability.html
/usr/share/doc/qt6/qtdoc/session.html
/usr/share/doc/qt6/qtdoc/sharedlibrary.html
/usr/share/doc/qt6/qtdoc/signalsandslots-syntaxes.html
/usr/share/doc/qt6/qtdoc/solutions-for-application-development.html
/usr/share/doc/qt6/qtdoc/solutions-for-ui-design.html
/usr/share/doc/qt6/qtdoc/sql-examples.html
/usr/share/doc/qt6/qtdoc/string-processing.html
/usr/share/doc/qt6/qtdoc/style
/usr/share/doc/qt6/qtdoc/style/offline-dark.css
/usr/share/doc/qt6/qtdoc/style/offline-simple.css
/usr/share/doc/qt6/qtdoc/style/offline.css
/usr/share/doc/qt6/qtdoc/style/qt5-sidebar.html
/usr/share/doc/qt6/qtdoc/supported-platforms.html
/usr/share/doc/qt6/qtdoc/testing-and-debugging.html
/usr/share/doc/qt6/qtdoc/third-party-libraries.html
/usr/share/doc/qt6/qtdoc/thread-basics.html
/usr/share/doc/qt6/qtdoc/thread.html
/usr/share/doc/qt6/qtdoc/threads-modules.html
/usr/share/doc/qt6/qtdoc/threads-qobject.html
/usr/share/doc/qt6/qtdoc/threads-reentrancy.html
/usr/share/doc/qt6/qtdoc/threads-synchronizing.html
/usr/share/doc/qt6/qtdoc/threads-technologies.html
/usr/share/doc/qt6/qtdoc/threads.html
/usr/share/doc/qt6/qtdoc/tools-for-qt-quick-uis.html
/usr/share/doc/qt6/qtdoc/tools-for-qt-widget-based-uis.html
/usr/share/doc/qt6/qtdoc/topics-app-development.html
/usr/share/doc/qt6/qtdoc/topics-core.html
/usr/share/doc/qt6/qtdoc/topics-data-io.html
/usr/share/doc/qt6/qtdoc/topics-graphics.html
/usr/share/doc/qt6/qtdoc/topics-network-connectivity.html
/usr/share/doc/qt6/qtdoc/topics-ui.html
/usr/share/doc/qt6/qtdoc/touchinputexamples.html
/usr/share/doc/qt6/qtdoc/trademarks.html
/usr/share/doc/qt6/qtdoc/uic.html
/usr/share/doc/qt6/qtdoc/unicode.html
/usr/share/doc/qt6/qtdoc/unix-signals.html
/usr/share/doc/qt6/qtdoc/wasm.html
/usr/share/doc/qt6/qtdoc/wayland-and-qt.html
/usr/share/doc/qt6/qtdoc/webos.html
/usr/share/doc/qt6/qtdoc/whatsnew60.html
/usr/share/doc/qt6/qtdoc/whatsnew61.html
/usr/share/doc/qt6/qtdoc/whatsnew62.html
/usr/share/doc/qt6/qtdoc/whatsnew63.html
/usr/share/doc/qt6/qtdoc/whatsnew64.html
/usr/share/doc/qt6/qtdoc/whatsnew65.html
/usr/share/doc/qt6/qtdoc/whatsnew66.html
/usr/share/doc/qt6/qtdoc/whatsnewqt6.html
/usr/share/doc/qt6/qtdoc/why-moc.html
/usr/share/doc/qt6/qtdoc/windows-building.html
/usr/share/doc/qt6/qtdoc/windows-deployment.html
/usr/share/doc/qt6/qtdoc/windows-graphics.html
/usr/share/doc/qt6/qtdoc/windows-issues.html
/usr/share/doc/qt6/qtdoc/windows.html
/usr/share/doc/qt6/qtdoc/xml-examples.html
/usr/share/doc/qt6/qtdoc/xml-processing.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/graphicaleffects5.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/images
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Blend_bug_and_butterfly.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Blend_mode1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Blend_mode10.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Blend_mode11.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Blend_mode12.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Blend_mode13.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Blend_mode14.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Blend_mode15.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Blend_mode16.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Blend_mode17.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Blend_mode18.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Blend_mode19.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Blend_mode2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Blend_mode20.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Blend_mode21.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Blend_mode22.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Blend_mode3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Blend_mode4.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Blend_mode5.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Blend_mode6.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Blend_mode7.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Blend_mode8.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Blend_mode9.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/BrightnessContrast_brightness1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/BrightnessContrast_brightness2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/BrightnessContrast_brightness3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/BrightnessContrast_bug.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/BrightnessContrast_contrast1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/BrightnessContrast_contrast2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/BrightnessContrast_contrast3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/BrightnessContrast_contrast_graph.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ColorOverlay_butterfly.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ColorOverlay_color1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ColorOverlay_color2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ColorOverlay_color3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Colorize_bug.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Colorize_hue1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Colorize_hue2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Colorize_hue3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Colorize_hue_scale.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Colorize_lightness1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Colorize_lightness2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Colorize_lightness3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Colorize_saturation1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Colorize_saturation2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Colorize_saturation3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ConicalGradient.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ConicalGradient_angle1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ConicalGradient_angle2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ConicalGradient_angle3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ConicalGradient_gradient1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ConicalGradient_gradient2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ConicalGradient_gradient3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ConicalGradient_horizontalOffset1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ConicalGradient_horizontalOffset2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ConicalGradient_horizontalOffset3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ConicalGradient_maskSource1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ConicalGradient_maskSource2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Desaturate_bug.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Desaturate_desaturation1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Desaturate_desaturation2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Desaturate_desaturation3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/DirectionalBlur_angle1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/DirectionalBlur_angle2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/DirectionalBlur_angle3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/DirectionalBlur_bug.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/DirectionalBlur_length1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/DirectionalBlur_length2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/DirectionalBlur_length3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Displace_bug.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Displace_displacement1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Displace_displacement2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Displace_displacement3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Displace_map.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/DropShadow-transparentBorder.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/DropShadow_butterfly.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/DropShadow_color1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/DropShadow_color2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/DropShadow_color3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/DropShadow_horizontalOffset1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/DropShadow_horizontalOffset2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/DropShadow_horizontalOffset3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/DropShadow_radius1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/DropShadow_radius2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/DropShadow_radius3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/DropShadow_spread1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/DropShadow_spread2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/DropShadow_spread3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/FastBlur_bug.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/FastBlur_radius1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/FastBlur_radius2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/FastBlur_radius3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/FastBlur_transparentBorder1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/FastBlur_transparentBorder2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/GammaAdjust_bug.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/GammaAdjust_gamma1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/GammaAdjust_gamma1_graph.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/GammaAdjust_gamma2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/GammaAdjust_gamma2_graph.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/GammaAdjust_gamma3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/GammaAdjust_gamma3_graph.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/GaussianBlur_bug.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/GaussianBlur_deviation1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/GaussianBlur_deviation2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/GaussianBlur_deviation3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/GaussianBlur_deviation_graph.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/GaussianBlur_radius1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/GaussianBlur_radius2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/GaussianBlur_radius3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/GaussianBlur_transparentBorder1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/GaussianBlur_transparentBorder2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Glow-transparentBorder.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Glow_butterfly.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Glow_color1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Glow_color2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Glow_color3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Glow_radius1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Glow_radius2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Glow_radius3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Glow_spread1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Glow_spread2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Glow_spread3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/HueSaturation_bug.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/HueSaturation_hue1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/HueSaturation_hue2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/HueSaturation_hue3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/HueSaturation_lightness1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/HueSaturation_lightness2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/HueSaturation_lightness3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/HueSaturation_saturation1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/HueSaturation_saturation2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/HueSaturation_saturation3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/InnerShadow_butterfly.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/InnerShadow_color1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/InnerShadow_color2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/InnerShadow_color3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/InnerShadow_fast1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/InnerShadow_fast2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/InnerShadow_horizontalOffset1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/InnerShadow_horizontalOffset2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/InnerShadow_horizontalOffset3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/InnerShadow_radius1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/InnerShadow_radius2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/InnerShadow_radius3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/InnerShadow_spread1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/InnerShadow_spread2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/InnerShadow_spread3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_butterfly.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_default_curve.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_gamma1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_gamma2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_gamma2_curve.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_gamma3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_gamma3_curve.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_maximumInput1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_maximumInput2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_maximumInput2_curve.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_maximumInput3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_maximumInput3_curve.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_maximumOutput1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_maximumOutput2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_maximumOutput2_curve.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_maximumOutput3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_maximumOutput3_curve.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_minimumInput1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_minimumInput2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_minimumInput2_curve.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_minimumInput3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_minimumInput3_curve.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_minimumOutput1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_minimumOutput2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_minimumOutput2_curve.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_minimumOutput3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LevelAdjust_minimumOutput3_curve.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LinearGradient.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LinearGradient_end1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LinearGradient_end2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LinearGradient_end3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LinearGradient_gradient1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LinearGradient_gradient2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LinearGradient_gradient3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LinearGradient_maskSource1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LinearGradient_maskSource2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LinearGradient_start1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LinearGradient_start2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/LinearGradient_start3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/MaskedBlur_bug.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/MaskedBlur_mask.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/MaskedBlur_radius1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/MaskedBlur_radius2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/MaskedBlur_radius3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/OpacityMask_bug.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/OpacityMask_mask.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Original_bug.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Original_butterfly.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/Original_butterfly_black.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RadialBlur_angle1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RadialBlur_angle2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RadialBlur_angle3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RadialBlur_bug.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RadialBlur_horizontalOffset1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RadialBlur_horizontalOffset2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RadialBlur_horizontalOffset3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RadialGradient.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RadialGradient_angle1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RadialGradient_angle2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RadialGradient_angle3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RadialGradient_gradient1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RadialGradient_gradient2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RadialGradient_gradient3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RadialGradient_horizontalOffset1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RadialGradient_horizontalOffset2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RadialGradient_horizontalOffset3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RadialGradient_horizontalRadius1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RadialGradient_horizontalRadius2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RadialGradient_maskSource1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RadialGradient_maskSource2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RectangularGlow_applied.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RectangularGlow_color1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RectangularGlow_color2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RectangularGlow_color3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RectangularGlow_cornerRadius1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RectangularGlow_cornerRadius2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RectangularGlow_cornerRadius3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RectangularGlow_glowRadius1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RectangularGlow_glowRadius2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RectangularGlow_glowRadius3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RectangularGlow_spread1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RectangularGlow_spread2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RectangularGlow_spread3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RecursiveBlur_bug.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RecursiveBlur_loops1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RecursiveBlur_loops2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RecursiveBlur_loops3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RecursiveBlur_radius1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RecursiveBlur_radius2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RecursiveBlur_radius3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RecursiveBlur_transparentBorder1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/RecursiveBlur_transparentBorder2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ThresholdMask_bug.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ThresholdMask_mask.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ThresholdMask_spread1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ThresholdMask_spread2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ThresholdMask_spread3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ThresholdMask_threshold1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ThresholdMask_threshold2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ThresholdMask_threshold3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ZoomBlur_bug.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ZoomBlur_horizontalOffset1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ZoomBlur_horizontalOffset2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ZoomBlur_horizontalOffset3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ZoomBlur_length1.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ZoomBlur_length2.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ZoomBlur_length3.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/arrow_bc.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/bgrContent.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/btn_next.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/btn_prev.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/bullet_dn.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/bullet_sq.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/home.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ico_note.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ico_note_attention.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/ico_out.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/images/logo.png
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-blend-members.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-blend.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-brightnesscontrast-members.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-brightnesscontrast.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-colorize-members.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-colorize.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-coloroverlay-members.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-coloroverlay.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-conicalgradient-members.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-conicalgradient.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-desaturate-members.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-desaturate.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-directionalblur-members.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-directionalblur.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-displace-members.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-displace.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-dropshadow-members.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-dropshadow.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-fastblur-members.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-fastblur.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-gammaadjust-members.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-gammaadjust.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-gaussianblur-members.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-gaussianblur.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-glow-members.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-glow.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-huesaturation-members.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-huesaturation.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-innershadow-members.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-innershadow.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-leveladjust-members.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-leveladjust.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-lineargradient-members.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-lineargradient.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-maskedblur-members.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-maskedblur.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-opacitymask-members.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-opacitymask.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-radialblur-members.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-radialblur.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-radialgradient-members.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-radialgradient.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-rectangularglow-members.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-rectangularglow.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-recursiveblur-members.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-recursiveblur.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-thresholdmask-members.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-thresholdmask.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-zoomblur-members.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qml-qt5compat-graphicaleffects-zoomblur.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qt5compat-graphicaleffects-qmlmodule.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qtgraphicaleffects5-index.html
/usr/share/doc/qt6/qtgraphicaleffects5compat/qtgraphicaleffects5compat.index
/usr/share/doc/qt6/qtgraphicaleffects5compat/qtgraphicaleffects5compat.qhp
/usr/share/doc/qt6/qtgraphicaleffects5compat/qtgraphicaleffects5compat.qhp.sha1
/usr/share/doc/qt6/qtgraphicaleffects5compat/style
/usr/share/doc/qt6/qtgraphicaleffects5compat/style/offline-dark.css
/usr/share/doc/qt6/qtgraphicaleffects5compat/style/offline-simple.css
/usr/share/doc/qt6/qtgraphicaleffects5compat/style/offline.css
/usr/share/doc/qt6/qtgraphs/examples-manifest.xml
/usr/share/doc/qt6/qtgraphs/graphs-examples.html
/usr/share/doc/qt6/qtgraphs/images
/usr/share/doc/qt6/qtgraphs/images/arrow_bc.png
/usr/share/doc/qt6/qtgraphs/images/axishandling-example.png
/usr/share/doc/qt6/qtgraphs/images/bars-example.png
/usr/share/doc/qt6/qtgraphs/images/bgrContent.png
/usr/share/doc/qt6/qtgraphs/images/btn_next.png
/usr/share/doc/qt6/qtgraphs/images/btn_prev.png
/usr/share/doc/qt6/qtgraphs/images/bullet_dn.png
/usr/share/doc/qt6/qtgraphs/images/bullet_sq.png
/usr/share/doc/qt6/qtgraphs/images/home.png
/usr/share/doc/qt6/qtgraphs/images/ico_note.png
/usr/share/doc/qt6/qtgraphs/images/ico_note_attention.png
/usr/share/doc/qt6/qtgraphs/images/ico_out.png
/usr/share/doc/qt6/qtgraphs/images/logo.png
/usr/share/doc/qt6/qtgraphs/images/q3dbars-minimal.png
/usr/share/doc/qt6/qtgraphs/images/q3dscatter-minimal.png
/usr/share/doc/qt6/qtgraphs/images/q3dsurface-minimal.png
/usr/share/doc/qt6/qtgraphs/images/scatter-example.png
/usr/share/doc/qt6/qtgraphs/images/surfacegallery-example.png
/usr/share/doc/qt6/qtgraphs/images/used-in-examples
/usr/share/doc/qt6/qtgraphs/images/used-in-examples/axishandling
/usr/share/doc/qt6/qtgraphs/images/used-in-examples/axishandling/qml
/usr/share/doc/qt6/qtgraphs/images/used-in-examples/axishandling/qml/axishandling
/usr/share/doc/qt6/qtgraphs/images/used-in-examples/axishandling/qml/axishandling/cubetexture.png
/usr/share/doc/qt6/qtgraphs/images/used-in-examples/surfacegallery
/usr/share/doc/qt6/qtgraphs/images/used-in-examples/surfacegallery/qml
/usr/share/doc/qt6/qtgraphs/images/used-in-examples/surfacegallery/qml/surfacegallery
/usr/share/doc/qt6/qtgraphs/images/used-in-examples/surfacegallery/qml/surfacegallery/heightmap.png
/usr/share/doc/qt6/qtgraphs/images/used-in-examples/widgetgraphgallery
/usr/share/doc/qt6/qtgraphs/images/used-in-examples/widgetgraphgallery/data
/usr/share/doc/qt6/qtgraphs/images/used-in-examples/widgetgraphgallery/data/layer_1.png
/usr/share/doc/qt6/qtgraphs/images/used-in-examples/widgetgraphgallery/data/layer_2.png
/usr/share/doc/qt6/qtgraphs/images/used-in-examples/widgetgraphgallery/data/layer_3.png
/usr/share/doc/qt6/qtgraphs/images/used-in-examples/widgetgraphgallery/data/maptexture.jpg
/usr/share/doc/qt6/qtgraphs/images/used-in-examples/widgetgraphgallery/data/topography.png
/usr/share/doc/qt6/qtgraphs/images/used-in-examples/widgetvolumetric
/usr/share/doc/qt6/qtgraphs/images/used-in-examples/widgetvolumetric/layer_ground.png
/usr/share/doc/qt6/qtgraphs/images/used-in-examples/widgetvolumetric/layer_magma.png
/usr/share/doc/qt6/qtgraphs/images/used-in-examples/widgetvolumetric/layer_water.png
/usr/share/doc/qt6/qtgraphs/images/widgetgraphgallery-example.png
/usr/share/doc/qt6/qtgraphs/images/widgetvolumetric-example.png
/usr/share/doc/qt6/qtgraphs/q3dbars-members.html
/usr/share/doc/qt6/qtgraphs/q3dbars.html
/usr/share/doc/qt6/qtgraphs/q3dcamera-members.html
/usr/share/doc/qt6/qtgraphs/q3dcamera.html
/usr/share/doc/qt6/qtgraphs/q3dinputhandler-members.html
/usr/share/doc/qt6/qtgraphs/q3dinputhandler.html
/usr/share/doc/qt6/qtgraphs/q3dlight-members.html
/usr/share/doc/qt6/qtgraphs/q3dlight.html
/usr/share/doc/qt6/qtgraphs/q3dobject-members.html
/usr/share/doc/qt6/qtgraphs/q3dobject.html
/usr/share/doc/qt6/qtgraphs/q3dscatter-members.html
/usr/share/doc/qt6/qtgraphs/q3dscatter.html
/usr/share/doc/qt6/qtgraphs/q3dscene-members.html
/usr/share/doc/qt6/qtgraphs/q3dscene.html
/usr/share/doc/qt6/qtgraphs/q3dsurface-members.html
/usr/share/doc/qt6/qtgraphs/q3dsurface.html
/usr/share/doc/qt6/qtgraphs/q3dtheme-members.html
/usr/share/doc/qt6/qtgraphs/q3dtheme.html
/usr/share/doc/qt6/qtgraphs/qabstract3daxis-members.html
/usr/share/doc/qt6/qtgraphs/qabstract3daxis.html
/usr/share/doc/qt6/qtgraphs/qabstract3dgraph-members.html
/usr/share/doc/qt6/qtgraphs/qabstract3dgraph.html
/usr/share/doc/qt6/qtgraphs/qabstract3dinputhandler-members.html
/usr/share/doc/qt6/qtgraphs/qabstract3dinputhandler.html
/usr/share/doc/qt6/qtgraphs/qabstract3dseries-members.html
/usr/share/doc/qt6/qtgraphs/qabstract3dseries.html
/usr/share/doc/qt6/qtgraphs/qabstractdataproxy-members.html
/usr/share/doc/qt6/qtgraphs/qabstractdataproxy.html
/usr/share/doc/qt6/qtgraphs/qbar3dseries-members.html
/usr/share/doc/qt6/qtgraphs/qbar3dseries.html
/usr/share/doc/qt6/qtgraphs/qbardataitem-members.html
/usr/share/doc/qt6/qtgraphs/qbardataitem.html
/usr/share/doc/qt6/qtgraphs/qbardataproxy-members.html
/usr/share/doc/qt6/qtgraphs/qbardataproxy.html
/usr/share/doc/qt6/qtgraphs/qcategory3daxis-members.html
/usr/share/doc/qt6/qtgraphs/qcategory3daxis.html
/usr/share/doc/qt6/qtgraphs/qcustom3ditem-members.html
/usr/share/doc/qt6/qtgraphs/qcustom3ditem.html
/usr/share/doc/qt6/qtgraphs/qcustom3dlabel-members.html
/usr/share/doc/qt6/qtgraphs/qcustom3dlabel.html
/usr/share/doc/qt6/qtgraphs/qcustom3dvolume-members.html
/usr/share/doc/qt6/qtgraphs/qcustom3dvolume.html
/usr/share/doc/qt6/qtgraphs/qheightmapsurfacedataproxy-members.html
/usr/share/doc/qt6/qtgraphs/qheightmapsurfacedataproxy.html
/usr/share/doc/qt6/qtgraphs/qitemmodelbardataproxy-members.html
/usr/share/doc/qt6/qtgraphs/qitemmodelbardataproxy.html
/usr/share/doc/qt6/qtgraphs/qitemmodelscatterdataproxy-members.html
/usr/share/doc/qt6/qtgraphs/qitemmodelscatterdataproxy.html
/usr/share/doc/qt6/qtgraphs/qitemmodelsurfacedataproxy-members.html
/usr/share/doc/qt6/qtgraphs/qitemmodelsurfacedataproxy.html
/usr/share/doc/qt6/qtgraphs/qlogvalue3daxisformatter-members.html
/usr/share/doc/qt6/qtgraphs/qlogvalue3daxisformatter.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-abstract3dseries-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-abstract3dseries.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-abstractaxis3d-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-abstractaxis3d.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-abstractdataproxy-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-abstractdataproxy.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-abstractgraph3d-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-abstractgraph3d.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-abstractinputhandler3d-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-abstractinputhandler3d.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-bar3dseries-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-bar3dseries.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-bardataproxy-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-bardataproxy.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-bars3d-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-bars3d.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-camera3d-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-camera3d.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-categoryaxis3d-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-categoryaxis3d.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-colorgradient-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-colorgradient.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-colorgradientstop-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-colorgradientstop.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-custom3ditem-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-custom3ditem.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-custom3dlabel-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-custom3dlabel.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-custom3dvolume-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-custom3dvolume.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-heightmapsurfacedataproxy-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-heightmapsurfacedataproxy.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-inputhandler3d-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-inputhandler3d.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-itemmodelbardataproxy-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-itemmodelbardataproxy.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-itemmodelscatterdataproxy-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-itemmodelscatterdataproxy.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-itemmodelsurfacedataproxy-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-itemmodelsurfacedataproxy.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-light3d-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-light3d.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-logvalueaxis3dformatter-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-logvalueaxis3dformatter.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-object3d-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-object3d.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-scatter3d-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-scatter3d.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-scatter3dseries-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-scatter3dseries.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-scatterdataproxy-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-scatterdataproxy.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-scene3d-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-scene3d.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-surface3d-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-surface3d.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-surface3dseries-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-surface3dseries.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-surfacedataproxy-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-surfacedataproxy.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-theme3d-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-theme3d.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-themecolor-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-themecolor.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-touchinputhandler3d-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-touchinputhandler3d.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-valueaxis3d-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-valueaxis3d.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-valueaxis3dformatter-members.html
/usr/share/doc/qt6/qtgraphs/qml-qtgraphs-valueaxis3dformatter.html
/usr/share/doc/qt6/qtgraphs/qscatter3dseries-members.html
/usr/share/doc/qt6/qtgraphs/qscatter3dseries.html
/usr/share/doc/qt6/qtgraphs/qscatterdataitem-members.html
/usr/share/doc/qt6/qtgraphs/qscatterdataitem.html
/usr/share/doc/qt6/qtgraphs/qscatterdataproxy-members.html
/usr/share/doc/qt6/qtgraphs/qscatterdataproxy.html
/usr/share/doc/qt6/qtgraphs/qsurface3dseries-members.html
/usr/share/doc/qt6/qtgraphs/qsurface3dseries.html
/usr/share/doc/qt6/qtgraphs/qsurfacedataitem-members.html
/usr/share/doc/qt6/qtgraphs/qsurfacedataitem.html
/usr/share/doc/qt6/qtgraphs/qsurfacedataproxy-members.html
/usr/share/doc/qt6/qtgraphs/qsurfacedataproxy.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-axishandling-axishandling-pro.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-axishandling-axishandling-qrc.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-axishandling-cmakelists-txt.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-axishandling-customformatter-cpp.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-axishandling-customformatter-h.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-axishandling-example.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-axishandling-main-cpp.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-axishandling-qml-axishandling-axisdragging-qml.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-axishandling-qml-axishandling-axisformatting-qml.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-axishandling-qml-axishandling-data-qml.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-axishandling-qml-axishandling-main-qml.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-axishandling-qmldir.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-bars-bars-pro.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-bars-bars-qrc.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-bars-cmakelists-txt.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-bars-example.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-bars-main-cpp.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-bars-qml-bars-axes-qml.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-bars-qml-bars-data-qml.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-bars-qml-bars-main-qml.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-data-handling.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-index.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-interacting-with-data.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-known-issues.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-migration-guide.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-module.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-overview.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-qmlmodule.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-scatter-cmakelists-txt.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-scatter-example.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-scatter-main-cpp.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-scatter-qml-scatter-data-qml.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-scatter-qml-scatter-main-qml.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-scatter-scatter-pro.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-scatter-scatter-qrc.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-surfacegallery-cmakelists-txt.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-surfacegallery-datasource-cpp.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-surfacegallery-datasource-h.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-surfacegallery-example.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-surfacegallery-main-cpp.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-surfacegallery-qml-surfacegallery-main-qml.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-surfacegallery-qml-surfacegallery-spectrogramdata-qml.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-surfacegallery-qml-surfacegallery-surfaceheightmap-qml.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-surfacegallery-qml-surfacegallery-surfaceoscilloscope-qml.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-surfacegallery-qml-surfacegallery-surfacespectrogram-qml.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-surfacegallery-surfacegallery-pro.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-surfacegallery-surfacegallery-qrc.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-axesinputhandler-cpp.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-axesinputhandler-h.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-bargraph-cpp.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-bargraph-h.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-cmakelists-txt.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-custominputhandler-cpp.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-custominputhandler-h.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-example.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-graphmodifier-cpp.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-graphmodifier-h.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-highlightseries-cpp.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-highlightseries-h.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-main-cpp.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-rainfalldata-cpp.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-rainfalldata-h.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-scatterdatamodifier-cpp.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-scatterdatamodifier-h.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-scattergraph-cpp.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-scattergraph-h.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-surfacegraph-cpp.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-surfacegraph-h.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-surfacegraphmodifier-cpp.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-surfacegraphmodifier-h.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-topographicseries-cpp.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-topographicseries-h.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-variantbardatamapping-cpp.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-variantbardatamapping-h.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-variantbardataproxy-cpp.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-variantbardataproxy-h.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-variantdataset-cpp.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-variantdataset-h.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-widgetgraphgallery-pro.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetgraphgallery-widgetgraphgallery-qrc.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetvolumetric-cmakelists-txt.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetvolumetric-example.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetvolumetric-main-cpp.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetvolumetric-volumetric-cpp.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetvolumetric-volumetric-h.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetvolumetric-widgetvolumetric-pro.html
/usr/share/doc/qt6/qtgraphs/qtgraphs-widgetvolumetric-widgetvolumetric-qrc.html
/usr/share/doc/qt6/qtgraphs/qtgraphs.index
/usr/share/doc/qt6/qtgraphs/qtgraphs.qhp
/usr/share/doc/qt6/qtgraphs/qtgraphs.qhp.sha1
/usr/share/doc/qt6/qtgraphs/qtouch3dinputhandler-members.html
/usr/share/doc/qt6/qtgraphs/qtouch3dinputhandler.html
/usr/share/doc/qt6/qtgraphs/qvalue3daxis-members.html
/usr/share/doc/qt6/qtgraphs/qvalue3daxis.html
/usr/share/doc/qt6/qtgraphs/qvalue3daxisformatter-members.html
/usr/share/doc/qt6/qtgraphs/qvalue3daxisformatter.html
/usr/share/doc/qt6/qtgraphs/style
/usr/share/doc/qt6/qtgraphs/style/offline-dark.css
/usr/share/doc/qt6/qtgraphs/style/offline-simple.css
/usr/share/doc/qt6/qtgraphs/style/offline.css
/usr/share/doc/qt6/qtgrpc/cmake-commands-qtgrpc.html
/usr/share/doc/qt6/qtgrpc/examples-manifest.xml
/usr/share/doc/qt6/qtgrpc/images
/usr/share/doc/qt6/qtgrpc/images/answer.webp
/usr/share/doc/qt6/qtgrpc/images/arrow_bc.png
/usr/share/doc/qt6/qtgrpc/images/bgrContent.png
/usr/share/doc/qt6/qtgrpc/images/btn_next.png
/usr/share/doc/qt6/qtgrpc/images/btn_prev.png
/usr/share/doc/qt6/qtgrpc/images/bullet_dn.png
/usr/share/doc/qt6/qtgrpc/images/bullet_sq.png
/usr/share/doc/qt6/qtgrpc/images/chatconversation.webp
/usr/share/doc/qt6/qtgrpc/images/chatlogin.webp
/usr/share/doc/qt6/qtgrpc/images/home.png
/usr/share/doc/qt6/qtgrpc/images/ico_note.png
/usr/share/doc/qt6/qtgrpc/images/ico_note_attention.png
/usr/share/doc/qt6/qtgrpc/images/ico_out.png
/usr/share/doc/qt6/qtgrpc/images/logo.png
/usr/share/doc/qt6/qtgrpc/qabstractgrpcchannel-members.html
/usr/share/doc/qt6/qtgrpc/qabstractgrpcchannel.html
/usr/share/doc/qt6/qtgrpc/qabstractgrpcclient-members.html
/usr/share/doc/qt6/qtgrpc/qabstractgrpcclient.html
/usr/share/doc/qt6/qtgrpc/qgrpccalloptions-members.html
/usr/share/doc/qt6/qtgrpc/qgrpccalloptions.html
/usr/share/doc/qt6/qtgrpc/qgrpccallreply-members.html
/usr/share/doc/qt6/qtgrpc/qgrpccallreply.html
/usr/share/doc/qt6/qtgrpc/qgrpcchannel-members.html
/usr/share/doc/qt6/qtgrpc/qgrpcchannel.html
/usr/share/doc/qt6/qtgrpc/qgrpcchanneloptions-members.html
/usr/share/doc/qt6/qtgrpc/qgrpcchanneloptions.html
/usr/share/doc/qt6/qtgrpc/qgrpchttp2channel-members.html
/usr/share/doc/qt6/qtgrpc/qgrpchttp2channel.html
/usr/share/doc/qt6/qtgrpc/qgrpcoperation-members.html
/usr/share/doc/qt6/qtgrpc/qgrpcoperation.html
/usr/share/doc/qt6/qtgrpc/qgrpcstatus-members.html
/usr/share/doc/qt6/qtgrpc/qgrpcstatus.html
/usr/share/doc/qt6/qtgrpc/qgrpcstream-members.html
/usr/share/doc/qt6/qtgrpc/qgrpcstream.html
/usr/share/doc/qt6/qtgrpc/qt-add-grpc.html
/usr/share/doc/qt6/qtgrpc/qtgrpc-attribution-grpc.html
/usr/share/doc/qt6/qtgrpc/qtgrpc-attribution-protobuf.html
/usr/share/doc/qt6/qtgrpc/qtgrpc-chat-example.html
/usr/share/doc/qt6/qtgrpc/qtgrpc-examples.html
/usr/share/doc/qt6/qtgrpc/qtgrpc-index.html
/usr/share/doc/qt6/qtgrpc/qtgrpc-magic8ball-example.html
/usr/share/doc/qt6/qtgrpc/qtgrpc-module.html
/usr/share/doc/qt6/qtgrpc/qtgrpc.index
/usr/share/doc/qt6/qtgrpc/qtgrpc.qhp
/usr/share/doc/qt6/qtgrpc/qtgrpc.qhp.sha1
/usr/share/doc/qt6/qtgrpc/qtgrpcgen-qt-tool.html
/usr/share/doc/qt6/qtgrpc/qtprotobufgen-qt-tool.html
/usr/share/doc/qt6/qtgrpc/style
/usr/share/doc/qt6/qtgrpc/style/offline-dark.css
/usr/share/doc/qt6/qtgrpc/style/offline-simple.css
/usr/share/doc/qt6/qtgrpc/style/offline.css
/usr/share/doc/qt6/qtgui/coordsys.html
/usr/share/doc/qt6/qtgui/dnd.html
/usr/share/doc/qt6/qtgui/examples-manifest.xml
/usr/share/doc/qt6/qtgui/gui-changes-qt6.html
/usr/share/doc/qt6/qtgui/images
/usr/share/doc/qt6/qtgui/images/alphafill.png
/usr/share/doc/qt6/qtgui/images/arrow_bc.png
/usr/share/doc/qt6/qtgui/images/bearings.png
/usr/share/doc/qt6/qtgui/images/bgrContent.png
/usr/share/doc/qt6/qtgui/images/brush-outline.png
/usr/share/doc/qt6/qtgui/images/brush-styles.png
/usr/share/doc/qt6/qtgui/images/btn_next.png
/usr/share/doc/qt6/qtgui/images/btn_prev.png
/usr/share/doc/qt6/qtgui/images/bullet_dn.png
/usr/share/doc/qt6/qtgui/images/bullet_sq.png
/usr/share/doc/qt6/qtgui/images/coordinatesystem-analogclock.png
/usr/share/doc/qt6/qtgui/images/coordinatesystem-line-antialias.png
/usr/share/doc/qt6/qtgui/images/coordinatesystem-line-raster.png
/usr/share/doc/qt6/qtgui/images/coordinatesystem-line.png
/usr/share/doc/qt6/qtgui/images/coordinatesystem-rect-antialias.png
/usr/share/doc/qt6/qtgui/images/coordinatesystem-rect-raster.png
/usr/share/doc/qt6/qtgui/images/coordinatesystem-rect.png
/usr/share/doc/qt6/qtgui/images/coordinatesystem-transformations.png
/usr/share/doc/qt6/qtgui/images/cursor-arrow.png
/usr/share/doc/qt6/qtgui/images/cursor-busy.png
/usr/share/doc/qt6/qtgui/images/cursor-closedhand.png
/usr/share/doc/qt6/qtgui/images/cursor-cross.png
/usr/share/doc/qt6/qtgui/images/cursor-forbidden.png
/usr/share/doc/qt6/qtgui/images/cursor-hand.png
/usr/share/doc/qt6/qtgui/images/cursor-hsplit.png
/usr/share/doc/qt6/qtgui/images/cursor-ibeam.png
/usr/share/doc/qt6/qtgui/images/cursor-openhand.png
/usr/share/doc/qt6/qtgui/images/cursor-sizeall.png
/usr/share/doc/qt6/qtgui/images/cursor-sizeb.png
/usr/share/doc/qt6/qtgui/images/cursor-sizef.png
/usr/share/doc/qt6/qtgui/images/cursor-sizeh.png
/usr/share/doc/qt6/qtgui/images/cursor-sizev.png
/usr/share/doc/qt6/qtgui/images/cursor-uparrow.png
/usr/share/doc/qt6/qtgui/images/cursor-vsplit.png
/usr/share/doc/qt6/qtgui/images/cursor-wait.png
/usr/share/doc/qt6/qtgui/images/cursor-whatsthis.png
/usr/share/doc/qt6/qtgui/images/hellovulkancubes.png
/usr/share/doc/qt6/qtgui/images/hellovulkantriangle.png
/usr/share/doc/qt6/qtgui/images/hellovulkanwidget.png
/usr/share/doc/qt6/qtgui/images/home.png
/usr/share/doc/qt6/qtgui/images/hoverevents.png
/usr/share/doc/qt6/qtgui/images/ico_note.png
/usr/share/doc/qt6/qtgui/images/ico_note_attention.png
/usr/share/doc/qt6/qtgui/images/ico_out.png
/usr/share/doc/qt6/qtgui/images/icon.png
/usr/share/doc/qt6/qtgui/images/logo.png
/usr/share/doc/qt6/qtgui/images/paintsystem-antialiasing.png
/usr/share/doc/qt6/qtgui/images/paintsystem-core.png
/usr/share/doc/qt6/qtgui/images/paintsystem-fancygradient.png
/usr/share/doc/qt6/qtgui/images/paintsystem-gradients.png
/usr/share/doc/qt6/qtgui/images/paintsystem-movie.png
/usr/share/doc/qt6/qtgui/images/paintsystem-painterpath.png
/usr/share/doc/qt6/qtgui/images/palette.png
/usr/share/doc/qt6/qtgui/images/plaintext-layout.png
/usr/share/doc/qt6/qtgui/images/qcolor-cmyk.png
/usr/share/doc/qt6/qtgui/images/qcolor-hsv.png
/usr/share/doc/qt6/qtgui/images/qcolor-hue.png
/usr/share/doc/qt6/qtgui/images/qcolor-rgb.png
/usr/share/doc/qt6/qtgui/images/qcolor-saturation.png
/usr/share/doc/qt6/qtgui/images/qcolor-value.png
/usr/share/doc/qt6/qtgui/images/qconicalgradient.png
/usr/share/doc/qt6/qtgui/images/qgradient-conical.png
/usr/share/doc/qt6/qtgui/images/qgradient-linear.png
/usr/share/doc/qt6/qtgui/images/qgradient-radial.png
/usr/share/doc/qt6/qtgui/images/qimage-32bit_scaled.png
/usr/share/doc/qt6/qtgui/images/qimage-8bit_scaled.png
/usr/share/doc/qt6/qtgui/images/qimage-scaling.png
/usr/share/doc/qt6/qtgui/images/qlineargradient-pad.png
/usr/share/doc/qt6/qtgui/images/qlineargradient-reflect.png
/usr/share/doc/qt6/qtgui/images/qlineargradient-repeat.png
/usr/share/doc/qt6/qtgui/images/qpainter-affinetransformations.png
/usr/share/doc/qt6/qtgui/images/qpainter-arc.png
/usr/share/doc/qt6/qtgui/images/qpainter-basicdrawing.png
/usr/share/doc/qt6/qtgui/images/qpainter-chord.png
/usr/share/doc/qt6/qtgui/images/qpainter-clock.png
/usr/share/doc/qt6/qtgui/images/qpainter-compositiondemo.png
/usr/share/doc/qt6/qtgui/images/qpainter-compositionmode1.png
/usr/share/doc/qt6/qtgui/images/qpainter-compositionmode2.png
/usr/share/doc/qt6/qtgui/images/qpainter-concentriccircles.png
/usr/share/doc/qt6/qtgui/images/qpainter-ellipse.png
/usr/share/doc/qt6/qtgui/images/qpainter-gradients.png
/usr/share/doc/qt6/qtgui/images/qpainter-line.png
/usr/share/doc/qt6/qtgui/images/qpainter-painterpaths.png
/usr/share/doc/qt6/qtgui/images/qpainter-path.png
/usr/share/doc/qt6/qtgui/images/qpainter-pathstroking.png
/usr/share/doc/qt6/qtgui/images/qpainter-pie.png
/usr/share/doc/qt6/qtgui/images/qpainter-polygon.png
/usr/share/doc/qt6/qtgui/images/qpainter-rectangle.png
/usr/share/doc/qt6/qtgui/images/qpainter-rotation.png
/usr/share/doc/qt6/qtgui/images/qpainter-roundrect.png
/usr/share/doc/qt6/qtgui/images/qpainter-scale.png
/usr/share/doc/qt6/qtgui/images/qpainter-text-bounds.png
/usr/share/doc/qt6/qtgui/images/qpainter-text.png
/usr/share/doc/qt6/qtgui/images/qpainter-translation.png
/usr/share/doc/qt6/qtgui/images/qpainter-vectordeformation.png
/usr/share/doc/qt6/qtgui/images/qpainterpath-addellipse.png
/usr/share/doc/qt6/qtgui/images/qpainterpath-addpolygon.png
/usr/share/doc/qt6/qtgui/images/qpainterpath-addrectangle.png
/usr/share/doc/qt6/qtgui/images/qpainterpath-addtext.png
/usr/share/doc/qt6/qtgui/images/qpainterpath-arcto.png
/usr/share/doc/qt6/qtgui/images/qpainterpath-construction.png
/usr/share/doc/qt6/qtgui/images/qpainterpath-cubicto.png
/usr/share/doc/qt6/qtgui/images/qpainterpath-demo.png
/usr/share/doc/qt6/qtgui/images/qpainterpath-example.png
/usr/share/doc/qt6/qtgui/images/qpen-bevel.png
/usr/share/doc/qt6/qtgui/images/qpen-custom.png
/usr/share/doc/qt6/qtgui/images/qpen-dash.png
/usr/share/doc/qt6/qtgui/images/qpen-dashdot.png
/usr/share/doc/qt6/qtgui/images/qpen-dashdotdot.png
/usr/share/doc/qt6/qtgui/images/qpen-dashpattern.png
/usr/share/doc/qt6/qtgui/images/qpen-demo.png
/usr/share/doc/qt6/qtgui/images/qpen-dot.png
/usr/share/doc/qt6/qtgui/images/qpen-flat.png
/usr/share/doc/qt6/qtgui/images/qpen-miter.png
/usr/share/doc/qt6/qtgui/images/qpen-miterlimit.png
/usr/share/doc/qt6/qtgui/images/qpen-roundcap.png
/usr/share/doc/qt6/qtgui/images/qpen-roundjoin.png
/usr/share/doc/qt6/qtgui/images/qpen-solid.png
/usr/share/doc/qt6/qtgui/images/qpen-square.png
/usr/share/doc/qt6/qtgui/images/qpixelformat-argb32buffer.png
/usr/share/doc/qt6/qtgui/images/qradialgradient-pad.png
/usr/share/doc/qt6/qtgui/images/qradialgradient-reflect.png
/usr/share/doc/qt6/qtgui/images/qradialgradient-repeat.png
/usr/share/doc/qt6/qtgui/images/qrect-diagram-zero.png
/usr/share/doc/qt6/qtgui/images/qrectf-diagram-one.png
/usr/share/doc/qt6/qtgui/images/qrectf-diagram-three.png
/usr/share/doc/qt6/qtgui/images/qrectf-diagram-two.png
/usr/share/doc/qt6/qtgui/images/qstatustipevent-action.png
/usr/share/doc/qt6/qtgui/images/qstatustipevent-widget.png
/usr/share/doc/qt6/qtgui/images/qt-colors.png
/usr/share/doc/qt6/qtgui/images/qt-fillrule-oddeven.png
/usr/share/doc/qt6/qtgui/images/qt-fillrule-winding.png
/usr/share/doc/qt6/qtgui/images/qtabletevent-tilt.png
/usr/share/doc/qt6/qtgui/images/qtextblock-sequence.png
/usr/share/doc/qt6/qtgui/images/qtextfragment-split.png
/usr/share/doc/qt6/qtgui/images/qtextframe-style.png
/usr/share/doc/qt6/qtgui/images/qtexttableformat-cell.png
/usr/share/doc/qt6/qtgui/images/qtransform-combinedtransformation.png
/usr/share/doc/qt6/qtgui/images/qtransform-combinedtransformation2.png
/usr/share/doc/qt6/qtgui/images/qtransform-representation.png
/usr/share/doc/qt6/qtgui/images/qtransform-simpletransformation.png
/usr/share/doc/qt6/qtgui/images/rhiwindow_example.jpg
/usr/share/doc/qt6/qtgui/images/richtext-document.png
/usr/share/doc/qt6/qtgui/images/rintersect.png
/usr/share/doc/qt6/qtgui/images/rsubtract.png
/usr/share/doc/qt6/qtgui/images/runion.png
/usr/share/doc/qt6/qtgui/images/rxor.png
/usr/share/doc/qt6/qtgui/images/texttable-merge.png
/usr/share/doc/qt6/qtgui/images/texttable-split.png
/usr/share/doc/qt6/qtgui/painting-3d.html
/usr/share/doc/qt6/qtgui/painting.html
/usr/share/doc/qt6/qtgui/paintsystem-devices.html
/usr/share/doc/qt6/qtgui/paintsystem-drawing.html
/usr/share/doc/qt6/qtgui/paintsystem-images.html
/usr/share/doc/qt6/qtgui/paintsystem.html
/usr/share/doc/qt6/qtgui/qabstractfileiconprovider-members.html
/usr/share/doc/qt6/qtgui/qabstractfileiconprovider.html
/usr/share/doc/qt6/qtgui/qabstracttextdocumentlayout-members.html
/usr/share/doc/qt6/qtgui/qabstracttextdocumentlayout-paintcontext-members.html
/usr/share/doc/qt6/qtgui/qabstracttextdocumentlayout-paintcontext.html
/usr/share/doc/qt6/qtgui/qabstracttextdocumentlayout-selection-members.html
/usr/share/doc/qt6/qtgui/qabstracttextdocumentlayout-selection.html
/usr/share/doc/qt6/qtgui/qabstracttextdocumentlayout.html
/usr/share/doc/qt6/qtgui/qaccessible-members.html
/usr/share/doc/qt6/qtgui/qaccessible-state-members.html
/usr/share/doc/qt6/qtgui/qaccessible-state.html
/usr/share/doc/qt6/qtgui/qaccessible.html
/usr/share/doc/qt6/qtgui/qaccessibleactioninterface-members.html
/usr/share/doc/qt6/qtgui/qaccessibleactioninterface.html
/usr/share/doc/qt6/qtgui/qaccessibleeditabletextinterface-members.html
/usr/share/doc/qt6/qtgui/qaccessibleeditabletextinterface.html
/usr/share/doc/qt6/qtgui/qaccessibleevent-members.html
/usr/share/doc/qt6/qtgui/qaccessibleevent.html
/usr/share/doc/qt6/qtgui/qaccessibleinterface-members.html
/usr/share/doc/qt6/qtgui/qaccessibleinterface.html
/usr/share/doc/qt6/qtgui/qaccessibleobject-members.html
/usr/share/doc/qt6/qtgui/qaccessibleobject.html
/usr/share/doc/qt6/qtgui/qaccessibleplugin-members.html
/usr/share/doc/qt6/qtgui/qaccessibleplugin.html
/usr/share/doc/qt6/qtgui/qaccessibleselectioninterface-members.html
/usr/share/doc/qt6/qtgui/qaccessibleselectioninterface.html
/usr/share/doc/qt6/qtgui/qaccessiblestatechangeevent-members.html
/usr/share/doc/qt6/qtgui/qaccessiblestatechangeevent.html
/usr/share/doc/qt6/qtgui/qaccessibletablecellinterface-members.html
/usr/share/doc/qt6/qtgui/qaccessibletablecellinterface.html
/usr/share/doc/qt6/qtgui/qaccessibletableinterface-members.html
/usr/share/doc/qt6/qtgui/qaccessibletableinterface.html
/usr/share/doc/qt6/qtgui/qaccessibletablemodelchangeevent-members.html
/usr/share/doc/qt6/qtgui/qaccessibletablemodelchangeevent.html
/usr/share/doc/qt6/qtgui/qaccessibletextcursorevent-members.html
/usr/share/doc/qt6/qtgui/qaccessibletextcursorevent.html
/usr/share/doc/qt6/qtgui/qaccessibletextinsertevent-members.html
/usr/share/doc/qt6/qtgui/qaccessibletextinsertevent.html
/usr/share/doc/qt6/qtgui/qaccessibletextinterface-members.html
/usr/share/doc/qt6/qtgui/qaccessibletextinterface.html
/usr/share/doc/qt6/qtgui/qaccessibletextremoveevent-members.html
/usr/share/doc/qt6/qtgui/qaccessibletextremoveevent.html
/usr/share/doc/qt6/qtgui/qaccessibletextselectionevent-members.html
/usr/share/doc/qt6/qtgui/qaccessibletextselectionevent.html
/usr/share/doc/qt6/qtgui/qaccessibletextupdateevent-members.html
/usr/share/doc/qt6/qtgui/qaccessibletextupdateevent.html
/usr/share/doc/qt6/qtgui/qaccessiblevaluechangeevent-members.html
/usr/share/doc/qt6/qtgui/qaccessiblevaluechangeevent.html
/usr/share/doc/qt6/qtgui/qaccessiblevalueinterface-members.html
/usr/share/doc/qt6/qtgui/qaccessiblevalueinterface.html
/usr/share/doc/qt6/qtgui/qaction-members.html
/usr/share/doc/qt6/qtgui/qaction-obsolete.html
/usr/share/doc/qt6/qtgui/qaction.html
/usr/share/doc/qt6/qtgui/qactionevent-members.html
/usr/share/doc/qt6/qtgui/qactionevent.html
/usr/share/doc/qt6/qtgui/qactiongroup-members.html
/usr/share/doc/qt6/qtgui/qactiongroup.html
/usr/share/doc/qt6/qtgui/qbackingstore-members.html
/usr/share/doc/qt6/qtgui/qbackingstore.html
/usr/share/doc/qt6/qtgui/qbitmap-members.html
/usr/share/doc/qt6/qtgui/qbitmap-obsolete.html
/usr/share/doc/qt6/qtgui/qbitmap.html
/usr/share/doc/qt6/qtgui/qbrush-members.html
/usr/share/doc/qt6/qtgui/qbrush.html
/usr/share/doc/qt6/qtgui/qclipboard-members.html
/usr/share/doc/qt6/qtgui/qclipboard.html
/usr/share/doc/qt6/qtgui/qcloseevent-members.html
/usr/share/doc/qt6/qtgui/qcloseevent.html
/usr/share/doc/qt6/qtgui/qcolor-members.html
/usr/share/doc/qt6/qtgui/qcolor-obsolete.html
/usr/share/doc/qt6/qtgui/qcolor.html
/usr/share/doc/qt6/qtgui/qcolorconstants.html
/usr/share/doc/qt6/qtgui/qcolorspace-members.html
/usr/share/doc/qt6/qtgui/qcolorspace.html
/usr/share/doc/qt6/qtgui/qcolortransform-members.html
/usr/share/doc/qt6/qtgui/qcolortransform.html
/usr/share/doc/qt6/qtgui/qconicalgradient-members.html
/usr/share/doc/qt6/qtgui/qconicalgradient.html
/usr/share/doc/qt6/qtgui/qcontextmenuevent-members.html
/usr/share/doc/qt6/qtgui/qcontextmenuevent-obsolete.html
/usr/share/doc/qt6/qtgui/qcontextmenuevent.html
/usr/share/doc/qt6/qtgui/qcursor-members.html
/usr/share/doc/qt6/qtgui/qcursor-obsolete.html
/usr/share/doc/qt6/qtgui/qcursor.html
/usr/share/doc/qt6/qtgui/qdesktopservices-members.html
/usr/share/doc/qt6/qtgui/qdesktopservices.html
/usr/share/doc/qt6/qtgui/qdoublevalidator-members.html
/usr/share/doc/qt6/qtgui/qdoublevalidator.html
/usr/share/doc/qt6/qtgui/qdrag-members.html
/usr/share/doc/qt6/qtgui/qdrag.html
/usr/share/doc/qt6/qtgui/qdragenterevent-members.html
/usr/share/doc/qt6/qtgui/qdragenterevent.html
/usr/share/doc/qt6/qtgui/qdragleaveevent-members.html
/usr/share/doc/qt6/qtgui/qdragleaveevent.html
/usr/share/doc/qt6/qtgui/qdragmoveevent-members.html
/usr/share/doc/qt6/qtgui/qdragmoveevent.html
/usr/share/doc/qt6/qtgui/qdropevent-members.html
/usr/share/doc/qt6/qtgui/qdropevent-obsolete.html
/usr/share/doc/qt6/qtgui/qdropevent.html
/usr/share/doc/qt6/qtgui/qenterevent-members.html
/usr/share/doc/qt6/qtgui/qenterevent-obsolete.html
/usr/share/doc/qt6/qtgui/qenterevent.html
/usr/share/doc/qt6/qtgui/qeventpoint-members.html
/usr/share/doc/qt6/qtgui/qeventpoint-obsolete.html
/usr/share/doc/qt6/qtgui/qeventpoint.html
/usr/share/doc/qt6/qtgui/qexposeevent-members.html
/usr/share/doc/qt6/qtgui/qexposeevent-obsolete.html
/usr/share/doc/qt6/qtgui/qexposeevent.html
/usr/share/doc/qt6/qtgui/qfileopenevent-members.html
/usr/share/doc/qt6/qtgui/qfileopenevent-obsolete.html
/usr/share/doc/qt6/qtgui/qfileopenevent.html
/usr/share/doc/qt6/qtgui/qfilesystemmodel-members.html
/usr/share/doc/qt6/qtgui/qfilesystemmodel.html
/usr/share/doc/qt6/qtgui/qfocusevent-members.html
/usr/share/doc/qt6/qtgui/qfocusevent.html
/usr/share/doc/qt6/qtgui/qfont-members.html
/usr/share/doc/qt6/qtgui/qfont-obsolete.html
/usr/share/doc/qt6/qtgui/qfont.html
/usr/share/doc/qt6/qtgui/qfontdatabase-members.html
/usr/share/doc/qt6/qtgui/qfontdatabase-obsolete.html
/usr/share/doc/qt6/qtgui/qfontdatabase.html
/usr/share/doc/qt6/qtgui/qfontinfo-members.html
/usr/share/doc/qt6/qtgui/qfontinfo-obsolete.html
/usr/share/doc/qt6/qtgui/qfontinfo.html
/usr/share/doc/qt6/qtgui/qfontmetrics-members.html
/usr/share/doc/qt6/qtgui/qfontmetrics.html
/usr/share/doc/qt6/qtgui/qfontmetricsf-members.html
/usr/share/doc/qt6/qtgui/qfontmetricsf.html
/usr/share/doc/qt6/qtgui/qgenericmatrix-members.html
/usr/share/doc/qt6/qtgui/qgenericmatrix.html
/usr/share/doc/qt6/qtgui/qgenericplugin-members.html
/usr/share/doc/qt6/qtgui/qgenericplugin.html
/usr/share/doc/qt6/qtgui/qgenericpluginfactory-members.html
/usr/share/doc/qt6/qtgui/qgenericpluginfactory.html
/usr/share/doc/qt6/qtgui/qglyphrun-members.html
/usr/share/doc/qt6/qtgui/qglyphrun.html
/usr/share/doc/qt6/qtgui/qgradient-members.html
/usr/share/doc/qt6/qtgui/qgradient.html
/usr/share/doc/qt6/qtgui/qguiapplication-members.html
/usr/share/doc/qt6/qtgui/qguiapplication-obsolete.html
/usr/share/doc/qt6/qtgui/qguiapplication.html
/usr/share/doc/qt6/qtgui/qhelpevent-members.html
/usr/share/doc/qt6/qtgui/qhelpevent.html
/usr/share/doc/qt6/qtgui/qhideevent-members.html
/usr/share/doc/qt6/qtgui/qhideevent.html
/usr/share/doc/qt6/qtgui/qhoverevent-members.html
/usr/share/doc/qt6/qtgui/qhoverevent-obsolete.html
/usr/share/doc/qt6/qtgui/qhoverevent.html
/usr/share/doc/qt6/qtgui/qicon-members.html
/usr/share/doc/qt6/qtgui/qicon-obsolete.html
/usr/share/doc/qt6/qtgui/qicon.html
/usr/share/doc/qt6/qtgui/qicondragevent-members.html
/usr/share/doc/qt6/qtgui/qicondragevent.html
/usr/share/doc/qt6/qtgui/qiconengine-members.html
/usr/share/doc/qt6/qtgui/qiconengine-scaledpixmapargument-members.html
/usr/share/doc/qt6/qtgui/qiconengine-scaledpixmapargument.html
/usr/share/doc/qt6/qtgui/qiconengine.html
/usr/share/doc/qt6/qtgui/qiconengineplugin-members.html
/usr/share/doc/qt6/qtgui/qiconengineplugin.html
/usr/share/doc/qt6/qtgui/qimage-members.html
/usr/share/doc/qt6/qtgui/qimage.html
/usr/share/doc/qt6/qtgui/qimageiohandler-members.html
/usr/share/doc/qt6/qtgui/qimageiohandler.html
/usr/share/doc/qt6/qtgui/qimageioplugin-members.html
/usr/share/doc/qt6/qtgui/qimageioplugin.html
/usr/share/doc/qt6/qtgui/qimagereader-members.html
/usr/share/doc/qt6/qtgui/qimagereader.html
/usr/share/doc/qt6/qtgui/qimagewriter-members.html
/usr/share/doc/qt6/qtgui/qimagewriter.html
/usr/share/doc/qt6/qtgui/qinputdevice-members.html
/usr/share/doc/qt6/qtgui/qinputdevice.html
/usr/share/doc/qt6/qtgui/qinputevent-members.html
/usr/share/doc/qt6/qtgui/qinputevent.html
/usr/share/doc/qt6/qtgui/qinputmethod-members.html
/usr/share/doc/qt6/qtgui/qinputmethod.html
/usr/share/doc/qt6/qtgui/qinputmethodevent-attribute-members.html
/usr/share/doc/qt6/qtgui/qinputmethodevent-attribute.html
/usr/share/doc/qt6/qtgui/qinputmethodevent-members.html
/usr/share/doc/qt6/qtgui/qinputmethodevent.html
/usr/share/doc/qt6/qtgui/qinputmethodqueryevent-members.html
/usr/share/doc/qt6/qtgui/qinputmethodqueryevent.html
/usr/share/doc/qt6/qtgui/qintvalidator-members.html
/usr/share/doc/qt6/qtgui/qintvalidator.html
/usr/share/doc/qt6/qtgui/qkeyevent-members.html
/usr/share/doc/qt6/qtgui/qkeyevent.html
/usr/share/doc/qt6/qtgui/qkeysequence-members.html
/usr/share/doc/qt6/qtgui/qkeysequence.html
/usr/share/doc/qt6/qtgui/qlineargradient-members.html
/usr/share/doc/qt6/qtgui/qlineargradient.html
/usr/share/doc/qt6/qtgui/qmatrix4x4-members.html
/usr/share/doc/qt6/qtgui/qmatrix4x4-obsolete.html
/usr/share/doc/qt6/qtgui/qmatrix4x4.html
/usr/share/doc/qt6/qtgui/qmouseevent-members.html
/usr/share/doc/qt6/qtgui/qmouseevent-obsolete.html
/usr/share/doc/qt6/qtgui/qmouseevent.html
/usr/share/doc/qt6/qtgui/qmoveevent-members.html
/usr/share/doc/qt6/qtgui/qmoveevent.html
/usr/share/doc/qt6/qtgui/qmovie-members.html
/usr/share/doc/qt6/qtgui/qmovie.html
/usr/share/doc/qt6/qtgui/qnativegestureevent-members.html
/usr/share/doc/qt6/qtgui/qnativegestureevent-obsolete.html
/usr/share/doc/qt6/qtgui/qnativegestureevent.html
/usr/share/doc/qt6/qtgui/qnativeinterface-qandroidoffscreensurface.html
/usr/share/doc/qt6/qtgui/qnativeinterface-qcocoaglcontext-members.html
/usr/share/doc/qt6/qtgui/qnativeinterface-qcocoaglcontext.html
/usr/share/doc/qt6/qtgui/qnativeinterface-qeglcontext-members.html
/usr/share/doc/qt6/qtgui/qnativeinterface-qeglcontext.html
/usr/share/doc/qt6/qtgui/qnativeinterface-qglxcontext-members.html
/usr/share/doc/qt6/qtgui/qnativeinterface-qglxcontext.html
/usr/share/doc/qt6/qtgui/qnativeinterface-qwaylandapplication-members.html
/usr/share/doc/qt6/qtgui/qnativeinterface-qwaylandapplication.html
/usr/share/doc/qt6/qtgui/qnativeinterface-qwglcontext-members.html
/usr/share/doc/qt6/qtgui/qnativeinterface-qwglcontext.html
/usr/share/doc/qt6/qtgui/qnativeinterface-qx11application-members.html
/usr/share/doc/qt6/qtgui/qnativeinterface-qx11application.html
/usr/share/doc/qt6/qtgui/qnativeinterface-sub-qtgui.html
/usr/share/doc/qt6/qtgui/qoffscreensurface-members.html
/usr/share/doc/qt6/qtgui/qoffscreensurface.html
/usr/share/doc/qt6/qtgui/qopenglcontext-members.html
/usr/share/doc/qt6/qtgui/qopenglcontext.html
/usr/share/doc/qt6/qtgui/qopenglcontextgroup-members.html
/usr/share/doc/qt6/qtgui/qopenglcontextgroup.html
/usr/share/doc/qt6/qtgui/qopenglextrafunctions-members.html
/usr/share/doc/qt6/qtgui/qopenglextrafunctions.html
/usr/share/doc/qt6/qtgui/qopenglfunctions-members.html
/usr/share/doc/qt6/qtgui/qopenglfunctions.html
/usr/share/doc/qt6/qtgui/qpagedpaintdevice-members.html
/usr/share/doc/qt6/qtgui/qpagedpaintdevice.html
/usr/share/doc/qt6/qtgui/qpagelayout-members.html
/usr/share/doc/qt6/qtgui/qpagelayout.html
/usr/share/doc/qt6/qtgui/qpageranges-members.html
/usr/share/doc/qt6/qtgui/qpageranges-range-members.html
/usr/share/doc/qt6/qtgui/qpageranges-range.html
/usr/share/doc/qt6/qtgui/qpageranges.html
/usr/share/doc/qt6/qtgui/qpagesize-members.html
/usr/share/doc/qt6/qtgui/qpagesize.html
/usr/share/doc/qt6/qtgui/qpaintdevice-members.html
/usr/share/doc/qt6/qtgui/qpaintdevice.html
/usr/share/doc/qt6/qtgui/qpaintdevicewindow-members.html
/usr/share/doc/qt6/qtgui/qpaintdevicewindow.html
/usr/share/doc/qt6/qtgui/qpaintengine-members.html
/usr/share/doc/qt6/qtgui/qpaintengine.html
/usr/share/doc/qt6/qtgui/qpaintenginestate-members.html
/usr/share/doc/qt6/qtgui/qpaintenginestate.html
/usr/share/doc/qt6/qtgui/qpainter-members.html
/usr/share/doc/qt6/qtgui/qpainter-pixmapfragment-members.html
/usr/share/doc/qt6/qtgui/qpainter-pixmapfragment.html
/usr/share/doc/qt6/qtgui/qpainter.html
/usr/share/doc/qt6/qtgui/qpainterpath-element-members.html
/usr/share/doc/qt6/qtgui/qpainterpath-element.html
/usr/share/doc/qt6/qtgui/qpainterpath-members.html
/usr/share/doc/qt6/qtgui/qpainterpath.html
/usr/share/doc/qt6/qtgui/qpainterpathstroker-members.html
/usr/share/doc/qt6/qtgui/qpainterpathstroker.html
/usr/share/doc/qt6/qtgui/qpaintevent-members.html
/usr/share/doc/qt6/qtgui/qpaintevent.html
/usr/share/doc/qt6/qtgui/qpalette-members.html
/usr/share/doc/qt6/qtgui/qpalette-obsolete.html
/usr/share/doc/qt6/qtgui/qpalette.html
/usr/share/doc/qt6/qtgui/qpdfwriter-members.html
/usr/share/doc/qt6/qtgui/qpdfwriter.html
/usr/share/doc/qt6/qtgui/qpen-members.html
/usr/share/doc/qt6/qtgui/qpen.html
/usr/share/doc/qt6/qtgui/qpicture-members.html
/usr/share/doc/qt6/qtgui/qpicture.html
/usr/share/doc/qt6/qtgui/qpixelformat-members.html
/usr/share/doc/qt6/qtgui/qpixelformat.html
/usr/share/doc/qt6/qtgui/qpixmap-members.html
/usr/share/doc/qt6/qtgui/qpixmap.html
/usr/share/doc/qt6/qtgui/qpixmapcache-key-members.html
/usr/share/doc/qt6/qtgui/qpixmapcache-key.html
/usr/share/doc/qt6/qtgui/qpixmapcache-members.html
/usr/share/doc/qt6/qtgui/qpixmapcache-obsolete.html
/usr/share/doc/qt6/qtgui/qpixmapcache.html
/usr/share/doc/qt6/qtgui/qplatformsurfaceevent-members.html
/usr/share/doc/qt6/qtgui/qplatformsurfaceevent.html
/usr/share/doc/qt6/qtgui/qpointerevent-members.html
/usr/share/doc/qt6/qtgui/qpointerevent.html
/usr/share/doc/qt6/qtgui/qpointingdevice-members.html
/usr/share/doc/qt6/qtgui/qpointingdevice.html
/usr/share/doc/qt6/qtgui/qpointingdeviceuniqueid-members.html
/usr/share/doc/qt6/qtgui/qpointingdeviceuniqueid.html
/usr/share/doc/qt6/qtgui/qpolygon-members.html
/usr/share/doc/qt6/qtgui/qpolygon.html
/usr/share/doc/qt6/qtgui/qpolygonf-members.html
/usr/share/doc/qt6/qtgui/qpolygonf.html
/usr/share/doc/qt6/qtgui/qquaternion-members.html
/usr/share/doc/qt6/qtgui/qquaternion.html
/usr/share/doc/qt6/qtgui/qradialgradient-members.html
/usr/share/doc/qt6/qtgui/qradialgradient.html
/usr/share/doc/qt6/qtgui/qrasterwindow-members.html
/usr/share/doc/qt6/qtgui/qrasterwindow.html
/usr/share/doc/qt6/qtgui/qrawfont-members.html
/usr/share/doc/qt6/qtgui/qrawfont.html
/usr/share/doc/qt6/qtgui/qregion-members.html
/usr/share/doc/qt6/qtgui/qregion.html
/usr/share/doc/qt6/qtgui/qregularexpressionvalidator-members.html
/usr/share/doc/qt6/qtgui/qregularexpressionvalidator.html
/usr/share/doc/qt6/qtgui/qresizeevent-members.html
/usr/share/doc/qt6/qtgui/qresizeevent.html
/usr/share/doc/qt6/qtgui/qrgba64-members.html
/usr/share/doc/qt6/qtgui/qrgba64.html
/usr/share/doc/qt6/qtgui/qrgbafloat-members.html
/usr/share/doc/qt6/qtgui/qrgbafloat.html
/usr/share/doc/qt6/qtgui/qrhi-members.html
/usr/share/doc/qt6/qtgui/qrhi.html
/usr/share/doc/qt6/qtgui/qrhibuffer-members.html
/usr/share/doc/qt6/qtgui/qrhibuffer-nativebuffer-members.html
/usr/share/doc/qt6/qtgui/qrhibuffer-nativebuffer.html
/usr/share/doc/qt6/qtgui/qrhibuffer.html
/usr/share/doc/qt6/qtgui/qrhicolorattachment-members.html
/usr/share/doc/qt6/qtgui/qrhicolorattachment.html
/usr/share/doc/qt6/qtgui/qrhicommandbuffer-members.html
/usr/share/doc/qt6/qtgui/qrhicommandbuffer.html
/usr/share/doc/qt6/qtgui/qrhicomputepipeline-members.html
/usr/share/doc/qt6/qtgui/qrhicomputepipeline.html
/usr/share/doc/qt6/qtgui/qrhid3d11initparams-members.html
/usr/share/doc/qt6/qtgui/qrhid3d11initparams.html
/usr/share/doc/qt6/qtgui/qrhid3d11nativehandles-members.html
/usr/share/doc/qt6/qtgui/qrhid3d11nativehandles.html
/usr/share/doc/qt6/qtgui/qrhid3d12commandbuffernativehandles-members.html
/usr/share/doc/qt6/qtgui/qrhid3d12commandbuffernativehandles.html
/usr/share/doc/qt6/qtgui/qrhid3d12initparams-members.html
/usr/share/doc/qt6/qtgui/qrhid3d12initparams.html
/usr/share/doc/qt6/qtgui/qrhid3d12nativehandles-members.html
/usr/share/doc/qt6/qtgui/qrhid3d12nativehandles.html
/usr/share/doc/qt6/qtgui/qrhidepthstencilclearvalue-members.html
/usr/share/doc/qt6/qtgui/qrhidepthstencilclearvalue.html
/usr/share/doc/qt6/qtgui/qrhidriverinfo-members.html
/usr/share/doc/qt6/qtgui/qrhidriverinfo.html
/usr/share/doc/qt6/qtgui/qrhigles2initparams-members.html
/usr/share/doc/qt6/qtgui/qrhigles2initparams.html
/usr/share/doc/qt6/qtgui/qrhigles2nativehandles-members.html
/usr/share/doc/qt6/qtgui/qrhigles2nativehandles.html
/usr/share/doc/qt6/qtgui/qrhigraphicspipeline-members.html
/usr/share/doc/qt6/qtgui/qrhigraphicspipeline-stencilopstate-members.html
/usr/share/doc/qt6/qtgui/qrhigraphicspipeline-stencilopstate.html
/usr/share/doc/qt6/qtgui/qrhigraphicspipeline-targetblend-members.html
/usr/share/doc/qt6/qtgui/qrhigraphicspipeline-targetblend.html
/usr/share/doc/qt6/qtgui/qrhigraphicspipeline.html
/usr/share/doc/qt6/qtgui/qrhiinitparams.html
/usr/share/doc/qt6/qtgui/qrhimetalcommandbuffernativehandles-members.html
/usr/share/doc/qt6/qtgui/qrhimetalcommandbuffernativehandles.html
/usr/share/doc/qt6/qtgui/qrhimetalinitparams.html
/usr/share/doc/qt6/qtgui/qrhimetalnativehandles-members.html
/usr/share/doc/qt6/qtgui/qrhimetalnativehandles.html
/usr/share/doc/qt6/qtgui/qrhinativehandles.html
/usr/share/doc/qt6/qtgui/qrhinullinitparams.html
/usr/share/doc/qt6/qtgui/qrhinullnativehandles.html
/usr/share/doc/qt6/qtgui/qrhireadbackdescription-members.html
/usr/share/doc/qt6/qtgui/qrhireadbackdescription.html
/usr/share/doc/qt6/qtgui/qrhireadbackresult-members.html
/usr/share/doc/qt6/qtgui/qrhireadbackresult.html
/usr/share/doc/qt6/qtgui/qrhirenderbuffer-members.html
/usr/share/doc/qt6/qtgui/qrhirenderbuffer-nativerenderbuffer-members.html
/usr/share/doc/qt6/qtgui/qrhirenderbuffer-nativerenderbuffer.html
/usr/share/doc/qt6/qtgui/qrhirenderbuffer.html
/usr/share/doc/qt6/qtgui/qrhirenderpassdescriptor-members.html
/usr/share/doc/qt6/qtgui/qrhirenderpassdescriptor.html
/usr/share/doc/qt6/qtgui/qrhirendertarget-members.html
/usr/share/doc/qt6/qtgui/qrhirendertarget.html
/usr/share/doc/qt6/qtgui/qrhiresource-members.html
/usr/share/doc/qt6/qtgui/qrhiresource.html
/usr/share/doc/qt6/qtgui/qrhiresourceupdatebatch-members.html
/usr/share/doc/qt6/qtgui/qrhiresourceupdatebatch.html
/usr/share/doc/qt6/qtgui/qrhisampler-members.html
/usr/share/doc/qt6/qtgui/qrhisampler.html
/usr/share/doc/qt6/qtgui/qrhiscissor-members.html
/usr/share/doc/qt6/qtgui/qrhiscissor.html
/usr/share/doc/qt6/qtgui/qrhishaderresourcebinding-members.html
/usr/share/doc/qt6/qtgui/qrhishaderresourcebinding.html
/usr/share/doc/qt6/qtgui/qrhishaderresourcebindings-members.html
/usr/share/doc/qt6/qtgui/qrhishaderresourcebindings.html
/usr/share/doc/qt6/qtgui/qrhishaderstage-members.html
/usr/share/doc/qt6/qtgui/qrhishaderstage.html
/usr/share/doc/qt6/qtgui/qrhistats-members.html
/usr/share/doc/qt6/qtgui/qrhistats.html
/usr/share/doc/qt6/qtgui/qrhiswapchain-members.html
/usr/share/doc/qt6/qtgui/qrhiswapchain.html
/usr/share/doc/qt6/qtgui/qrhiswapchainhdrinfo-members.html
/usr/share/doc/qt6/qtgui/qrhiswapchainhdrinfo.html
/usr/share/doc/qt6/qtgui/qrhiswapchainproxydata.html
/usr/share/doc/qt6/qtgui/qrhiswapchainrendertarget-members.html
/usr/share/doc/qt6/qtgui/qrhiswapchainrendertarget.html
/usr/share/doc/qt6/qtgui/qrhitexture-members.html
/usr/share/doc/qt6/qtgui/qrhitexture-nativetexture-members.html
/usr/share/doc/qt6/qtgui/qrhitexture-nativetexture.html
/usr/share/doc/qt6/qtgui/qrhitexture.html
/usr/share/doc/qt6/qtgui/qrhitexturecopydescription-members.html
/usr/share/doc/qt6/qtgui/qrhitexturecopydescription.html
/usr/share/doc/qt6/qtgui/qrhitexturerendertarget-members.html
/usr/share/doc/qt6/qtgui/qrhitexturerendertarget.html
/usr/share/doc/qt6/qtgui/qrhitexturerendertargetdescription-members.html
/usr/share/doc/qt6/qtgui/qrhitexturerendertargetdescription.html
/usr/share/doc/qt6/qtgui/qrhitexturesubresourceuploaddescription-members.html
/usr/share/doc/qt6/qtgui/qrhitexturesubresourceuploaddescription.html
/usr/share/doc/qt6/qtgui/qrhitextureuploaddescription-members.html
/usr/share/doc/qt6/qtgui/qrhitextureuploaddescription.html
/usr/share/doc/qt6/qtgui/qrhitextureuploadentry-members.html
/usr/share/doc/qt6/qtgui/qrhitextureuploadentry.html
/usr/share/doc/qt6/qtgui/qrhivertexinputattribute-members.html
/usr/share/doc/qt6/qtgui/qrhivertexinputattribute.html
/usr/share/doc/qt6/qtgui/qrhivertexinputbinding-members.html
/usr/share/doc/qt6/qtgui/qrhivertexinputbinding.html
/usr/share/doc/qt6/qtgui/qrhivertexinputlayout-members.html
/usr/share/doc/qt6/qtgui/qrhivertexinputlayout.html
/usr/share/doc/qt6/qtgui/qrhiviewport-members.html
/usr/share/doc/qt6/qtgui/qrhiviewport.html
/usr/share/doc/qt6/qtgui/qrhivulkancommandbuffernativehandles-members.html
/usr/share/doc/qt6/qtgui/qrhivulkancommandbuffernativehandles.html
/usr/share/doc/qt6/qtgui/qrhivulkaninitparams-members.html
/usr/share/doc/qt6/qtgui/qrhivulkaninitparams.html
/usr/share/doc/qt6/qtgui/qrhivulkannativehandles-members.html
/usr/share/doc/qt6/qtgui/qrhivulkannativehandles.html
/usr/share/doc/qt6/qtgui/qrhivulkanrenderpassnativehandles-members.html
/usr/share/doc/qt6/qtgui/qrhivulkanrenderpassnativehandles.html
/usr/share/doc/qt6/qtgui/qscreen-members.html
/usr/share/doc/qt6/qtgui/qscreen.html
/usr/share/doc/qt6/qtgui/qscrollevent-members.html
/usr/share/doc/qt6/qtgui/qscrollevent.html
/usr/share/doc/qt6/qtgui/qscrollprepareevent-members.html
/usr/share/doc/qt6/qtgui/qscrollprepareevent.html
/usr/share/doc/qt6/qtgui/qsessionmanager-members.html
/usr/share/doc/qt6/qtgui/qsessionmanager.html
/usr/share/doc/qt6/qtgui/qshader-members.html
/usr/share/doc/qt6/qtgui/qshader-nativeshaderinfo-members.html
/usr/share/doc/qt6/qtgui/qshader-nativeshaderinfo.html
/usr/share/doc/qt6/qtgui/qshader-separatetocombinedimagesamplermapping-members.html
/usr/share/doc/qt6/qtgui/qshader-separatetocombinedimagesamplermapping.html
/usr/share/doc/qt6/qtgui/qshader.html
/usr/share/doc/qt6/qtgui/qshadercode-members.html
/usr/share/doc/qt6/qtgui/qshadercode.html
/usr/share/doc/qt6/qtgui/qshaderdescription-blockvariable-members.html
/usr/share/doc/qt6/qtgui/qshaderdescription-blockvariable.html
/usr/share/doc/qt6/qtgui/qshaderdescription-builtinvariable-members.html
/usr/share/doc/qt6/qtgui/qshaderdescription-builtinvariable.html
/usr/share/doc/qt6/qtgui/qshaderdescription-inoutvariable-members.html
/usr/share/doc/qt6/qtgui/qshaderdescription-inoutvariable.html
/usr/share/doc/qt6/qtgui/qshaderdescription-members.html
/usr/share/doc/qt6/qtgui/qshaderdescription-pushconstantblock-members.html
/usr/share/doc/qt6/qtgui/qshaderdescription-pushconstantblock.html
/usr/share/doc/qt6/qtgui/qshaderdescription-storageblock-members.html
/usr/share/doc/qt6/qtgui/qshaderdescription-storageblock.html
/usr/share/doc/qt6/qtgui/qshaderdescription-uniformblock-members.html
/usr/share/doc/qt6/qtgui/qshaderdescription-uniformblock.html
/usr/share/doc/qt6/qtgui/qshaderdescription.html
/usr/share/doc/qt6/qtgui/qshaderkey-members.html
/usr/share/doc/qt6/qtgui/qshaderkey.html
/usr/share/doc/qt6/qtgui/qshaderversion-members.html
/usr/share/doc/qt6/qtgui/qshaderversion.html
/usr/share/doc/qt6/qtgui/qshortcut-members.html
/usr/share/doc/qt6/qtgui/qshortcut-obsolete.html
/usr/share/doc/qt6/qtgui/qshortcut.html
/usr/share/doc/qt6/qtgui/qshortcutevent-members.html
/usr/share/doc/qt6/qtgui/qshortcutevent-obsolete.html
/usr/share/doc/qt6/qtgui/qshortcutevent.html
/usr/share/doc/qt6/qtgui/qshowevent-members.html
/usr/share/doc/qt6/qtgui/qshowevent.html
/usr/share/doc/qt6/qtgui/qsinglepointevent-members.html
/usr/share/doc/qt6/qtgui/qsinglepointevent.html
/usr/share/doc/qt6/qtgui/qstandarditem-members.html
/usr/share/doc/qt6/qtgui/qstandarditem.html
/usr/share/doc/qt6/qtgui/qstandarditemmodel-members.html
/usr/share/doc/qt6/qtgui/qstandarditemmodel.html
/usr/share/doc/qt6/qtgui/qstatictext-members.html
/usr/share/doc/qt6/qtgui/qstatictext.html
/usr/share/doc/qt6/qtgui/qstatustipevent-members.html
/usr/share/doc/qt6/qtgui/qstatustipevent.html
/usr/share/doc/qt6/qtgui/qstylehints-members.html
/usr/share/doc/qt6/qtgui/qstylehints-obsolete.html
/usr/share/doc/qt6/qtgui/qstylehints.html
/usr/share/doc/qt6/qtgui/qsupportedwritingsystems-members.html
/usr/share/doc/qt6/qtgui/qsupportedwritingsystems.html
/usr/share/doc/qt6/qtgui/qsurface-members.html
/usr/share/doc/qt6/qtgui/qsurface.html
/usr/share/doc/qt6/qtgui/qsurfaceformat-members.html
/usr/share/doc/qt6/qtgui/qsurfaceformat-obsolete.html
/usr/share/doc/qt6/qtgui/qsurfaceformat.html
/usr/share/doc/qt6/qtgui/qsyntaxhighlighter-members.html
/usr/share/doc/qt6/qtgui/qsyntaxhighlighter.html
/usr/share/doc/qt6/qtgui/qt-sub-qtgui.html
/usr/share/doc/qt6/qtgui/qtabletevent-members.html
/usr/share/doc/qt6/qtgui/qtabletevent-obsolete.html
/usr/share/doc/qt6/qtgui/qtabletevent.html
/usr/share/doc/qt6/qtgui/qtextblock-iterator-members.html
/usr/share/doc/qt6/qtgui/qtextblock-iterator.html
/usr/share/doc/qt6/qtgui/qtextblock-members.html
/usr/share/doc/qt6/qtgui/qtextblock.html
/usr/share/doc/qt6/qtgui/qtextblockformat-members.html
/usr/share/doc/qt6/qtgui/qtextblockformat.html
/usr/share/doc/qt6/qtgui/qtextblockgroup-members.html
/usr/share/doc/qt6/qtgui/qtextblockgroup.html
/usr/share/doc/qt6/qtgui/qtextblockuserdata-members.html
/usr/share/doc/qt6/qtgui/qtextblockuserdata.html
/usr/share/doc/qt6/qtgui/qtextcharformat-members.html
/usr/share/doc/qt6/qtgui/qtextcharformat-obsolete.html
/usr/share/doc/qt6/qtgui/qtextcharformat.html
/usr/share/doc/qt6/qtgui/qtextcursor-members.html
/usr/share/doc/qt6/qtgui/qtextcursor.html
/usr/share/doc/qt6/qtgui/qtextdocument-members.html
/usr/share/doc/qt6/qtgui/qtextdocument.html
/usr/share/doc/qt6/qtgui/qtextdocumentfragment-members.html
/usr/share/doc/qt6/qtgui/qtextdocumentfragment.html
/usr/share/doc/qt6/qtgui/qtextdocumentwriter-members.html
/usr/share/doc/qt6/qtgui/qtextdocumentwriter.html
/usr/share/doc/qt6/qtgui/qtextformat-members.html
/usr/share/doc/qt6/qtgui/qtextformat.html
/usr/share/doc/qt6/qtgui/qtextfragment-members.html
/usr/share/doc/qt6/qtgui/qtextfragment.html
/usr/share/doc/qt6/qtgui/qtextframe-iterator-members.html
/usr/share/doc/qt6/qtgui/qtextframe-iterator.html
/usr/share/doc/qt6/qtgui/qtextframe-members.html
/usr/share/doc/qt6/qtgui/qtextframe.html
/usr/share/doc/qt6/qtgui/qtextframeformat-members.html
/usr/share/doc/qt6/qtgui/qtextframeformat.html
/usr/share/doc/qt6/qtgui/qtextimageformat-members.html
/usr/share/doc/qt6/qtgui/qtextimageformat.html
/usr/share/doc/qt6/qtgui/qtextinlineobject-members.html
/usr/share/doc/qt6/qtgui/qtextinlineobject.html
/usr/share/doc/qt6/qtgui/qtextitem-members.html
/usr/share/doc/qt6/qtgui/qtextitem.html
/usr/share/doc/qt6/qtgui/qtextlayout-formatrange-members.html
/usr/share/doc/qt6/qtgui/qtextlayout-formatrange.html
/usr/share/doc/qt6/qtgui/qtextlayout-members.html
/usr/share/doc/qt6/qtgui/qtextlayout.html
/usr/share/doc/qt6/qtgui/qtextlength-members.html
/usr/share/doc/qt6/qtgui/qtextlength.html
/usr/share/doc/qt6/qtgui/qtextline-members.html
/usr/share/doc/qt6/qtgui/qtextline.html
/usr/share/doc/qt6/qtgui/qtextlist-members.html
/usr/share/doc/qt6/qtgui/qtextlist.html
/usr/share/doc/qt6/qtgui/qtextlistformat-members.html
/usr/share/doc/qt6/qtgui/qtextlistformat.html
/usr/share/doc/qt6/qtgui/qtextobject-members.html
/usr/share/doc/qt6/qtgui/qtextobject.html
/usr/share/doc/qt6/qtgui/qtextobjectinterface-members.html
/usr/share/doc/qt6/qtgui/qtextobjectinterface.html
/usr/share/doc/qt6/qtgui/qtextoption-members.html
/usr/share/doc/qt6/qtgui/qtextoption-tab-members.html
/usr/share/doc/qt6/qtgui/qtextoption-tab.html
/usr/share/doc/qt6/qtgui/qtextoption.html
/usr/share/doc/qt6/qtgui/qtexttable-members.html
/usr/share/doc/qt6/qtgui/qtexttable.html
/usr/share/doc/qt6/qtgui/qtexttablecell-members.html
/usr/share/doc/qt6/qtgui/qtexttablecell.html
/usr/share/doc/qt6/qtgui/qtexttablecellformat-members.html
/usr/share/doc/qt6/qtgui/qtexttablecellformat.html
/usr/share/doc/qt6/qtgui/qtexttableformat-members.html
/usr/share/doc/qt6/qtgui/qtexttableformat.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-aglfn.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-android-native-style.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-cocoa-platform-plugin.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-d3d12memoryallocator.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-dejayvu.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-freetype-bdf.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-freetype-pcf.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-freetype-zlib.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-freetype.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-grayraster.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-harfbuzz-ng.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-iaccessible2.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-icc-srgb-color-profile.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-libjpeg.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-libpng.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-md4c.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-opengl-es2-headers.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-opengl-headers.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-pixman.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-rhi-miniengine-d3d12-mipmap.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-smooth-scaling-algorithm.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-vera-font.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-vulkan-xml-spec.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-vulkanmemoryallocator.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-webgradients.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-wintab.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-xcb-xinput.html
/usr/share/doc/qt6/qtgui/qtgui-attribution-xserverhelper.html
/usr/share/doc/qt6/qtgui/qtgui-hellovulkancubes-example.html
/usr/share/doc/qt6/qtgui/qtgui-hellovulkantriangle-example.html
/usr/share/doc/qt6/qtgui/qtgui-hellovulkanwidget-example.html
/usr/share/doc/qt6/qtgui/qtgui-index.html
/usr/share/doc/qt6/qtgui/qtgui-module.html
/usr/share/doc/qt6/qtgui/qtgui-overview.html
/usr/share/doc/qt6/qtgui/qtgui-rasterwindow-example.html
/usr/share/doc/qt6/qtgui/qtgui-rhiwindow-example.html
/usr/share/doc/qt6/qtgui/qtgui.index
/usr/share/doc/qt6/qtgui/qtgui.qhp
/usr/share/doc/qt6/qtgui/qtgui.qhp.sha1
/usr/share/doc/qt6/qtgui/qtouchevent-members.html
/usr/share/doc/qt6/qtgui/qtouchevent-obsolete.html
/usr/share/doc/qt6/qtgui/qtouchevent.html
/usr/share/doc/qt6/qtgui/qtransform-members.html
/usr/share/doc/qt6/qtgui/qtransform.html
/usr/share/doc/qt6/qtgui/qundocommand-members.html
/usr/share/doc/qt6/qtgui/qundocommand.html
/usr/share/doc/qt6/qtgui/qundogroup-members.html
/usr/share/doc/qt6/qtgui/qundogroup.html
/usr/share/doc/qt6/qtgui/qundostack-members.html
/usr/share/doc/qt6/qtgui/qundostack.html
/usr/share/doc/qt6/qtgui/qutimimeconverter-members.html
/usr/share/doc/qt6/qtgui/qutimimeconverter.html
/usr/share/doc/qt6/qtgui/qvalidator-members.html
/usr/share/doc/qt6/qtgui/qvalidator.html
/usr/share/doc/qt6/qtgui/qvector2d-members.html
/usr/share/doc/qt6/qtgui/qvector2d.html
/usr/share/doc/qt6/qtgui/qvector3d-members.html
/usr/share/doc/qt6/qtgui/qvector3d.html
/usr/share/doc/qt6/qtgui/qvector4d-members.html
/usr/share/doc/qt6/qtgui/qvector4d.html
/usr/share/doc/qt6/qtgui/qvulkandevicefunctions.html
/usr/share/doc/qt6/qtgui/qvulkanextension-members.html
/usr/share/doc/qt6/qtgui/qvulkanextension.html
/usr/share/doc/qt6/qtgui/qvulkanfunctions.html
/usr/share/doc/qt6/qtgui/qvulkaninfovector-members.html
/usr/share/doc/qt6/qtgui/qvulkaninfovector.html
/usr/share/doc/qt6/qtgui/qvulkaninstance-members.html
/usr/share/doc/qt6/qtgui/qvulkaninstance.html
/usr/share/doc/qt6/qtgui/qvulkanlayer-members.html
/usr/share/doc/qt6/qtgui/qvulkanlayer.html
/usr/share/doc/qt6/qtgui/qvulkanwindow-members.html
/usr/share/doc/qt6/qtgui/qvulkanwindow.html
/usr/share/doc/qt6/qtgui/qvulkanwindowrenderer-members.html
/usr/share/doc/qt6/qtgui/qvulkanwindowrenderer.html
/usr/share/doc/qt6/qtgui/qwhatsthisclickedevent-members.html
/usr/share/doc/qt6/qtgui/qwhatsthisclickedevent.html
/usr/share/doc/qt6/qtgui/qwheelevent-members.html
/usr/share/doc/qt6/qtgui/qwheelevent-obsolete.html
/usr/share/doc/qt6/qtgui/qwheelevent.html
/usr/share/doc/qt6/qtgui/qwindow-members.html
/usr/share/doc/qt6/qtgui/qwindow.html
/usr/share/doc/qt6/qtgui/qwindowsmimeconverter-members.html
/usr/share/doc/qt6/qtgui/qwindowsmimeconverter.html
/usr/share/doc/qt6/qtgui/qwindowstatechangeevent-members.html
/usr/share/doc/qt6/qtgui/qwindowstatechangeevent.html
/usr/share/doc/qt6/qtgui/richtext-advanced-processing.html
/usr/share/doc/qt6/qtgui/richtext-common-tasks.html
/usr/share/doc/qt6/qtgui/richtext-cursor.html
/usr/share/doc/qt6/qtgui/richtext-html-subset.html
/usr/share/doc/qt6/qtgui/richtext-layouts.html
/usr/share/doc/qt6/qtgui/richtext-processing.html
/usr/share/doc/qt6/qtgui/richtext-structure.html
/usr/share/doc/qt6/qtgui/richtext.html
/usr/share/doc/qt6/qtgui/style
/usr/share/doc/qt6/qtgui/style/offline-dark.css
/usr/share/doc/qt6/qtgui/style/offline-simple.css
/usr/share/doc/qt6/qtgui/style/offline.css
/usr/share/doc/qt6/qthelp/examples-manifest.xml
/usr/share/doc/qt6/qthelp/examples-qthelp.html
/usr/share/doc/qt6/qthelp/helpsystem.html
/usr/share/doc/qt6/qthelp/images
/usr/share/doc/qt6/qthelp/images/arrow_bc.png
/usr/share/doc/qt6/qthelp/images/bgrContent.png
/usr/share/doc/qt6/qthelp/images/btn_next.png
/usr/share/doc/qt6/qthelp/images/btn_prev.png
/usr/share/doc/qt6/qthelp/images/bullet_dn.png
/usr/share/doc/qt6/qthelp/images/bullet_sq.png
/usr/share/doc/qt6/qthelp/images/home.png
/usr/share/doc/qt6/qthelp/images/ico_note.png
/usr/share/doc/qt6/qthelp/images/ico_note_attention.png
/usr/share/doc/qt6/qthelp/images/ico_out.png
/usr/share/doc/qt6/qthelp/images/logo.png
/usr/share/doc/qt6/qthelp/qcompressedhelpinfo-members.html
/usr/share/doc/qt6/qthelp/qcompressedhelpinfo.html
/usr/share/doc/qt6/qthelp/qhelpcontentitem-members.html
/usr/share/doc/qt6/qthelp/qhelpcontentitem.html
/usr/share/doc/qt6/qthelp/qhelpcontentmodel-members.html
/usr/share/doc/qt6/qthelp/qhelpcontentmodel.html
/usr/share/doc/qt6/qthelp/qhelpcontentwidget-members.html
/usr/share/doc/qt6/qthelp/qhelpcontentwidget.html
/usr/share/doc/qt6/qthelp/qhelpengine-members.html
/usr/share/doc/qt6/qthelp/qhelpengine.html
/usr/share/doc/qt6/qthelp/qhelpenginecore-members.html
/usr/share/doc/qt6/qthelp/qhelpenginecore-obsolete.html
/usr/share/doc/qt6/qthelp/qhelpenginecore.html
/usr/share/doc/qt6/qthelp/qhelpfilterdata-members.html
/usr/share/doc/qt6/qthelp/qhelpfilterdata.html
/usr/share/doc/qt6/qthelp/qhelpfilterengine-members.html
/usr/share/doc/qt6/qthelp/qhelpfilterengine.html
/usr/share/doc/qt6/qthelp/qhelpfiltersettingswidget-members.html
/usr/share/doc/qt6/qthelp/qhelpfiltersettingswidget.html
/usr/share/doc/qt6/qthelp/qhelpindexmodel-members.html
/usr/share/doc/qt6/qthelp/qhelpindexmodel.html
/usr/share/doc/qt6/qthelp/qhelpindexwidget-members.html
/usr/share/doc/qt6/qthelp/qhelpindexwidget-obsolete.html
/usr/share/doc/qt6/qthelp/qhelpindexwidget.html
/usr/share/doc/qt6/qthelp/qhelplink-members.html
/usr/share/doc/qt6/qthelp/qhelplink.html
/usr/share/doc/qt6/qthelp/qhelpsearchengine-members.html
/usr/share/doc/qt6/qthelp/qhelpsearchengine-obsolete.html
/usr/share/doc/qt6/qthelp/qhelpsearchengine.html
/usr/share/doc/qt6/qthelp/qhelpsearchquery-members.html
/usr/share/doc/qt6/qthelp/qhelpsearchquery-obsolete.html
/usr/share/doc/qt6/qthelp/qhelpsearchquery.html
/usr/share/doc/qt6/qthelp/qhelpsearchquerywidget-members.html
/usr/share/doc/qt6/qthelp/qhelpsearchquerywidget-obsolete.html
/usr/share/doc/qt6/qthelp/qhelpsearchquerywidget.html
/usr/share/doc/qt6/qthelp/qhelpsearchresult-members.html
/usr/share/doc/qt6/qthelp/qhelpsearchresult.html
/usr/share/doc/qt6/qthelp/qhelpsearchresultwidget-members.html
/usr/share/doc/qt6/qthelp/qhelpsearchresultwidget.html
/usr/share/doc/qt6/qthelp/qthelp-contextsensitivehelp-example.html
/usr/share/doc/qt6/qthelp/qthelp-framework.html
/usr/share/doc/qt6/qthelp/qthelp-index.html
/usr/share/doc/qt6/qthelp/qthelp-module.html
/usr/share/doc/qt6/qthelp/qthelp.index
/usr/share/doc/qt6/qthelp/qthelp.qhp
/usr/share/doc/qt6/qthelp/qthelp.qhp.sha1
/usr/share/doc/qt6/qthelp/qthelpproject.html
/usr/share/doc/qt6/qthelp/style
/usr/share/doc/qt6/qthelp/style/offline-dark.css
/usr/share/doc/qt6/qthelp/style/offline-simple.css
/usr/share/doc/qt6/qthelp/style/offline.css
/usr/share/doc/qt6/qthttpserver/examples-manifest.xml
/usr/share/doc/qt6/qthttpserver/images
/usr/share/doc/qt6/qthttpserver/images/arrow_bc.png
/usr/share/doc/qt6/qthttpserver/images/bgrContent.png
/usr/share/doc/qt6/qthttpserver/images/browserwindow.png
/usr/share/doc/qt6/qthttpserver/images/btn_next.png
/usr/share/doc/qt6/qthttpserver/images/btn_prev.png
/usr/share/doc/qt6/qthttpserver/images/bullet_dn.png
/usr/share/doc/qt6/qthttpserver/images/bullet_sq.png
/usr/share/doc/qt6/qthttpserver/images/home.png
/usr/share/doc/qt6/qthttpserver/images/ico_note.png
/usr/share/doc/qt6/qthttpserver/images/ico_note_attention.png
/usr/share/doc/qt6/qthttpserver/images/ico_out.png
/usr/share/doc/qt6/qthttpserver/images/logo.png
/usr/share/doc/qt6/qthttpserver/images/restful-color-palette-server-example.png
/usr/share/doc/qt6/qthttpserver/images/used-in-examples
/usr/share/doc/qt6/qthttpserver/images/used-in-examples/colorpalette
/usr/share/doc/qt6/qthttpserver/images/used-in-examples/colorpalette/assets
/usr/share/doc/qt6/qthttpserver/images/used-in-examples/colorpalette/assets/img
/usr/share/doc/qt6/qthttpserver/images/used-in-examples/colorpalette/assets/img/1-image.jpg
/usr/share/doc/qt6/qthttpserver/images/used-in-examples/colorpalette/assets/img/10-image.jpg
/usr/share/doc/qt6/qthttpserver/images/used-in-examples/colorpalette/assets/img/11-image.jpg
/usr/share/doc/qt6/qthttpserver/images/used-in-examples/colorpalette/assets/img/12-image.jpg
/usr/share/doc/qt6/qthttpserver/images/used-in-examples/colorpalette/assets/img/2-image.jpg
/usr/share/doc/qt6/qthttpserver/images/used-in-examples/colorpalette/assets/img/3-image.jpg
/usr/share/doc/qt6/qthttpserver/images/used-in-examples/colorpalette/assets/img/4-image.jpg
/usr/share/doc/qt6/qthttpserver/images/used-in-examples/colorpalette/assets/img/5-image.jpg
/usr/share/doc/qt6/qthttpserver/images/used-in-examples/colorpalette/assets/img/6-image.jpg
/usr/share/doc/qt6/qthttpserver/images/used-in-examples/colorpalette/assets/img/7-image.jpg
/usr/share/doc/qt6/qthttpserver/images/used-in-examples/colorpalette/assets/img/8-image.jpg
/usr/share/doc/qt6/qthttpserver/images/used-in-examples/colorpalette/assets/img/9-image.jpg
/usr/share/doc/qt6/qthttpserver/images/used-in-examples/simple
/usr/share/doc/qt6/qthttpserver/images/used-in-examples/simple/assets
/usr/share/doc/qt6/qthttpserver/images/used-in-examples/simple/assets/qt-logo.png
/usr/share/doc/qt6/qthttpserver/qabstracthttpserver-members.html
/usr/share/doc/qt6/qthttpserver/qabstracthttpserver.html
/usr/share/doc/qt6/qthttpserver/qhttpserver-members.html
/usr/share/doc/qt6/qthttpserver/qhttpserver.html
/usr/share/doc/qt6/qthttpserver/qhttpserverrequest-members.html
/usr/share/doc/qt6/qthttpserver/qhttpserverrequest.html
/usr/share/doc/qt6/qthttpserver/qhttpserverresponder-members.html
/usr/share/doc/qt6/qthttpserver/qhttpserverresponder.html
/usr/share/doc/qt6/qthttpserver/qhttpserverresponse-members.html
/usr/share/doc/qt6/qthttpserver/qhttpserverresponse.html
/usr/share/doc/qt6/qthttpserver/qhttpserverrouter-members.html
/usr/share/doc/qt6/qthttpserver/qhttpserverrouter.html
/usr/share/doc/qt6/qthttpserver/qhttpserverrouterrule-members.html
/usr/share/doc/qt6/qthttpserver/qhttpserverrouterrule.html
/usr/share/doc/qt6/qthttpserver/qthttpserver-colorpalette-apibehavior-h.html
/usr/share/doc/qt6/qthttpserver/qthttpserver-colorpalette-cmakelists-txt.html
/usr/share/doc/qt6/qthttpserver/qthttpserver-colorpalette-colorpalette-pro.html
/usr/share/doc/qt6/qthttpserver/qthttpserver-colorpalette-example.html
/usr/share/doc/qt6/qthttpserver/qthttpserver-colorpalette-main-cpp.html
/usr/share/doc/qt6/qthttpserver/qthttpserver-colorpalette-types-h.html
/usr/share/doc/qt6/qthttpserver/qthttpserver-colorpalette-utils-h.html
/usr/share/doc/qt6/qthttpserver/qthttpserver-examples.html
/usr/share/doc/qt6/qthttpserver/qthttpserver-index.html
/usr/share/doc/qt6/qthttpserver/qthttpserver-logging.html
/usr/share/doc/qt6/qthttpserver/qthttpserver-module.html
/usr/share/doc/qt6/qthttpserver/qthttpserver-simple-cmakelists-txt.html
/usr/share/doc/qt6/qthttpserver/qthttpserver-simple-example.html
/usr/share/doc/qt6/qthttpserver/qthttpserver-simple-main-cpp.html
/usr/share/doc/qt6/qthttpserver/qthttpserver-simple-simple-pro.html
/usr/share/doc/qt6/qthttpserver/qthttpserver.index
/usr/share/doc/qt6/qthttpserver/qthttpserver.qhp
/usr/share/doc/qt6/qthttpserver/qthttpserver.qhp.sha1
/usr/share/doc/qt6/qthttpserver/style
/usr/share/doc/qt6/qthttpserver/style/offline-dark.css
/usr/share/doc/qt6/qthttpserver/style/offline-simple.css
/usr/share/doc/qt6/qthttpserver/style/offline.css
/usr/share/doc/qt6/qtimageformats/images
/usr/share/doc/qt6/qtimageformats/images/arrow_bc.png
/usr/share/doc/qt6/qtimageformats/images/bgrContent.png
/usr/share/doc/qt6/qtimageformats/images/btn_next.png
/usr/share/doc/qt6/qtimageformats/images/btn_prev.png
/usr/share/doc/qt6/qtimageformats/images/bullet_dn.png
/usr/share/doc/qt6/qtimageformats/images/bullet_sq.png
/usr/share/doc/qt6/qtimageformats/images/home.png
/usr/share/doc/qt6/qtimageformats/images/ico_note.png
/usr/share/doc/qt6/qtimageformats/images/ico_note_attention.png
/usr/share/doc/qt6/qtimageformats/images/ico_out.png
/usr/share/doc/qt6/qtimageformats/images/logo.png
/usr/share/doc/qt6/qtimageformats/qtimageformats-attribution-libtiff.html
/usr/share/doc/qt6/qtimageformats/qtimageformats-attribution-libwebp.html
/usr/share/doc/qt6/qtimageformats/qtimageformats-index.html
/usr/share/doc/qt6/qtimageformats/qtimageformats.index
/usr/share/doc/qt6/qtimageformats/qtimageformats.qhp
/usr/share/doc/qt6/qtimageformats/qtimageformats.qhp.sha1
/usr/share/doc/qt6/qtimageformats/style
/usr/share/doc/qt6/qtimageformats/style/offline-dark.css
/usr/share/doc/qt6/qtimageformats/style/offline-simple.css
/usr/share/doc/qt6/qtimageformats/style/offline.css
/usr/share/doc/qt6/qtlabsplatform/images
/usr/share/doc/qt6/qtlabsplatform/images/arrow_bc.png
/usr/share/doc/qt6/qtlabsplatform/images/bgrContent.png
/usr/share/doc/qt6/qtlabsplatform/images/btn_next.png
/usr/share/doc/qt6/qtlabsplatform/images/btn_prev.png
/usr/share/doc/qt6/qtlabsplatform/images/bullet_dn.png
/usr/share/doc/qt6/qtlabsplatform/images/bullet_sq.png
/usr/share/doc/qt6/qtlabsplatform/images/home.png
/usr/share/doc/qt6/qtlabsplatform/images/ico_note.png
/usr/share/doc/qt6/qtlabsplatform/images/ico_note_attention.png
/usr/share/doc/qt6/qtlabsplatform/images/ico_out.png
/usr/share/doc/qt6/qtlabsplatform/images/logo.png
/usr/share/doc/qt6/qtlabsplatform/images/qtlabsplatform-colordialog-gtk.png
/usr/share/doc/qt6/qtlabsplatform/images/qtlabsplatform-filedialog-gtk.png
/usr/share/doc/qt6/qtlabsplatform/images/qtlabsplatform-folderdialog-gtk.png
/usr/share/doc/qt6/qtlabsplatform/images/qtlabsplatform-fontdialog-gtk.png
/usr/share/doc/qt6/qtlabsplatform/images/qtlabsplatform-menu.png
/usr/share/doc/qt6/qtlabsplatform/images/qtlabsplatform-menubar.png
/usr/share/doc/qt6/qtlabsplatform/images/qtlabsplatform-messagedialog-android.png
/usr/share/doc/qt6/qtlabsplatform/images/qtlabsplatform-messagedialog-informative-android.png
/usr/share/doc/qt6/qtlabsplatform/images/qtlabsplatform-systemtrayicon-menu.png
/usr/share/doc/qt6/qtlabsplatform/images/qtlabsplatform-systemtrayicon-message.png
/usr/share/doc/qt6/qtlabsplatform/images/qtlabsplatform-systemtrayicon.png
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-colordialog-members.html
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-colordialog.html
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-dialog-members.html
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-dialog.html
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-filedialog-members.html
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-filedialog.html
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-folderdialog-members.html
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-folderdialog.html
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-fontdialog-members.html
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-fontdialog.html
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-menu-members.html
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-menu.html
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-menubar-members.html
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-menubar.html
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-menuitem-members.html
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-menuitem.html
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-menuitemgroup-members.html
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-menuitemgroup.html
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-menuseparator-members.html
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-menuseparator.html
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-messagedialog-members.html
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-messagedialog.html
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-standardpaths-members.html
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-standardpaths.html
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-systemtrayicon-members.html
/usr/share/doc/qt6/qtlabsplatform/qml-qt-labs-platform-systemtrayicon.html
/usr/share/doc/qt6/qtlabsplatform/qt-labs-platform-qmlmodule.html
/usr/share/doc/qt6/qtlabsplatform/qtlabsplatform-index.html
/usr/share/doc/qt6/qtlabsplatform/qtlabsplatform.index
/usr/share/doc/qt6/qtlabsplatform/qtlabsplatform.qhp
/usr/share/doc/qt6/qtlabsplatform/qtlabsplatform.qhp.sha1
/usr/share/doc/qt6/qtlabsplatform/qtquicklabsplatform-changes-qt6.html
/usr/share/doc/qt6/qtlabsplatform/style
/usr/share/doc/qt6/qtlabsplatform/style/offline-dark.css
/usr/share/doc/qt6/qtlabsplatform/style/offline-simple.css
/usr/share/doc/qt6/qtlabsplatform/style/offline.css
/usr/share/doc/qt6/qtlinguist/cmake-commands-qtlinguisttools.html
/usr/share/doc/qt6/qtlinguist/examples-linguist.html
/usr/share/doc/qt6/qtlinguist/examples-manifest.xml
/usr/share/doc/qt6/qtlinguist/images
/usr/share/doc/qt6/qtlinguist/images/arrow_bc.png
/usr/share/doc/qt6/qtlinguist/images/bgrContent.png
/usr/share/doc/qt6/qtlinguist/images/btn_next.png
/usr/share/doc/qt6/qtlinguist/images/btn_prev.png
/usr/share/doc/qt6/qtlinguist/images/bullet_dn.png
/usr/share/doc/qt6/qtlinguist/images/bullet_sq.png
/usr/share/doc/qt6/qtlinguist/images/front-coding.png
/usr/share/doc/qt6/qtlinguist/images/front-publishing.png
/usr/share/doc/qt6/qtlinguist/images/front-ui.png
/usr/share/doc/qt6/qtlinguist/images/home.png
/usr/share/doc/qt6/qtlinguist/images/ico_note.png
/usr/share/doc/qt6/qtlinguist/images/ico_note_attention.png
/usr/share/doc/qt6/qtlinguist/images/ico_out.png
/usr/share/doc/qt6/qtlinguist/images/linguist-arrowpad_en.png
/usr/share/doc/qt6/qtlinguist/images/linguist-arrowpad_fr.png
/usr/share/doc/qt6/qtlinguist/images/linguist-arrowpad_nl.png
/usr/share/doc/qt6/qtlinguist/images/linguist-batchtranslation.png
/usr/share/doc/qt6/qtlinguist/images/linguist-check-empty.png
/usr/share/doc/qt6/qtlinguist/images/linguist-check-obsolete.png
/usr/share/doc/qt6/qtlinguist/images/linguist-check-off.png
/usr/share/doc/qt6/qtlinguist/images/linguist-check-on.png
/usr/share/doc/qt6/qtlinguist/images/linguist-check-warning.png
/usr/share/doc/qt6/qtlinguist/images/linguist-context-view.webp
/usr/share/doc/qt6/qtlinguist/images/linguist-danger.png
/usr/share/doc/qt6/qtlinguist/images/linguist-doneandnext.png
/usr/share/doc/qt6/qtlinguist/images/linguist-hellotr_en.png
/usr/share/doc/qt6/qtlinguist/images/linguist-hellotr_la.png
/usr/share/doc/qt6/qtlinguist/images/linguist-i18n.png
/usr/share/doc/qt6/qtlinguist/images/linguist-linguist.png
/usr/share/doc/qt6/qtlinguist/images/linguist-linguist_2.png
/usr/share/doc/qt6/qtlinguist/images/linguist-phrasebookdialog.png
/usr/share/doc/qt6/qtlinguist/images/linguist-strings-view.webp
/usr/share/doc/qt6/qtlinguist/images/linguist-translationfilesettings.png
/usr/share/doc/qt6/qtlinguist/images/linguist-trollprint_10_en.png
/usr/share/doc/qt6/qtlinguist/images/linguist-trollprint_10_pt_bad.png
/usr/share/doc/qt6/qtlinguist/images/linguist-trollprint_10_pt_good.png
/usr/share/doc/qt6/qtlinguist/images/linguist-trollprint_11_en.png
/usr/share/doc/qt6/qtlinguist/images/linguist-trollprint_11_pt.png
/usr/share/doc/qt6/qtlinguist/images/linguist-ui.webp
/usr/share/doc/qt6/qtlinguist/images/logo.png
/usr/share/doc/qt6/qtlinguist/images/next.png
/usr/share/doc/qt6/qtlinguist/images/nextunfinished.png
/usr/share/doc/qt6/qtlinguist/images/xNIz78IPBu0.jpg
/usr/share/doc/qt6/qtlinguist/linguist-creating-ts-files.html
/usr/share/doc/qt6/qtlinguist/linguist-id-based-i18n.html
/usr/share/doc/qt6/qtlinguist/linguist-lrelease.html
/usr/share/doc/qt6/qtlinguist/linguist-lupdate.html
/usr/share/doc/qt6/qtlinguist/linguist-manager.html
/usr/share/doc/qt6/qtlinguist/linguist-programmers.html
/usr/share/doc/qt6/qtlinguist/linguist-reusing-translations.html
/usr/share/doc/qt6/qtlinguist/linguist-selecting-context.html
/usr/share/doc/qt6/qtlinguist/linguist-selecting-strings.html
/usr/share/doc/qt6/qtlinguist/linguist-toc.html
/usr/share/doc/qt6/qtlinguist/linguist-translating-multiple-languages.html
/usr/share/doc/qt6/qtlinguist/linguist-translating-strings.html
/usr/share/doc/qt6/qtlinguist/linguist-translators.html
/usr/share/doc/qt6/qtlinguist/linguist-ts-file-format.html
/usr/share/doc/qt6/qtlinguist/linguist-ui.html
/usr/share/doc/qt6/qtlinguist/linguist-validating-translations.html
/usr/share/doc/qt6/qtlinguist/linguist-viewing-strings-in-context.html
/usr/share/doc/qt6/qtlinguist/qtlinguist-arrowpad-example.html
/usr/share/doc/qt6/qtlinguist/qtlinguist-cmake-qt-add-lrelease.html
/usr/share/doc/qt6/qtlinguist/qtlinguist-cmake-qt-add-lupdate.html
/usr/share/doc/qt6/qtlinguist/qtlinguist-cmake-qt-add-translation.html
/usr/share/doc/qt6/qtlinguist/qtlinguist-cmake-qt-add-translations.html
/usr/share/doc/qt6/qtlinguist/qtlinguist-cmake-qt-create-translation.html
/usr/share/doc/qt6/qtlinguist/qtlinguist-hellotr-example.html
/usr/share/doc/qt6/qtlinguist/qtlinguist-i18n-example.html
/usr/share/doc/qt6/qtlinguist/qtlinguist-index.html
/usr/share/doc/qt6/qtlinguist/qtlinguist-trollprint-example.html
/usr/share/doc/qt6/qtlinguist/qtlinguist.index
/usr/share/doc/qt6/qtlinguist/qtlinguist.qhp
/usr/share/doc/qt6/qtlinguist/qtlinguist.qhp.sha1
/usr/share/doc/qt6/qtlinguist/style
/usr/share/doc/qt6/qtlinguist/style/offline-dark.css
/usr/share/doc/qt6/qtlinguist/style/offline-simple.css
/usr/share/doc/qt6/qtlinguist/style/offline.css
/usr/share/doc/qt6/qtlocation/examples-manifest.xml
/usr/share/doc/qt6/qtlocation/images
/usr/share/doc/qt6/qtlocation/images/api-mapcircle.png
/usr/share/doc/qt6/qtlocation/images/api-mapitemgroup.png
/usr/share/doc/qt6/qtlocation/images/api-mappolygon.png
/usr/share/doc/qt6/qtlocation/images/api-mappolyline.png
/usr/share/doc/qt6/qtlocation/images/api-mapquickitem-anchor.png
/usr/share/doc/qt6/qtlocation/images/api-mapquickitem.png
/usr/share/doc/qt6/qtlocation/images/api-maprectangle.png
/usr/share/doc/qt6/qtlocation/images/arrow_bc.png
/usr/share/doc/qt6/qtlocation/images/bgrContent.png
/usr/share/doc/qt6/qtlocation/images/btn_next.png
/usr/share/doc/qt6/qtlocation/images/btn_prev.png
/usr/share/doc/qt6/qtlocation/images/bullet_dn.png
/usr/share/doc/qt6/qtlocation/images/bullet_sq.png
/usr/share/doc/qt6/qtlocation/images/geojson_viewer.png
/usr/share/doc/qt6/qtlocation/images/home.png
/usr/share/doc/qt6/qtlocation/images/ico_note.png
/usr/share/doc/qt6/qtlocation/images/ico_note_attention.png
/usr/share/doc/qt6/qtlocation/images/ico_out.png
/usr/share/doc/qt6/qtlocation/images/itemview_transitions.jpg
/usr/share/doc/qt6/qtlocation/images/logo.png
/usr/share/doc/qt6/qtlocation/images/mapviewer.png
/usr/share/doc/qt6/qtlocation/images/minimal_map.png
/usr/share/doc/qt6/qtlocation/images/places.png
/usr/share/doc/qt6/qtlocation/images/places_list.png
/usr/share/doc/qt6/qtlocation/images/places_map.png
/usr/share/doc/qt6/qtlocation/images/planespotter.png
/usr/share/doc/qt6/qtlocation/location-maps-cpp.html
/usr/share/doc/qt6/qtlocation/location-maps-qml.html
/usr/share/doc/qt6/qtlocation/location-places-backend.html
/usr/share/doc/qt6/qtlocation/location-places-cpp.html
/usr/share/doc/qt6/qtlocation/location-places-qml.html
/usr/share/doc/qt6/qtlocation/location-plugin-itemsoverlay.html
/usr/share/doc/qt6/qtlocation/location-plugin-osm.html
/usr/share/doc/qt6/qtlocation/qgeocodereply-members.html
/usr/share/doc/qt6/qtlocation/qgeocodereply.html
/usr/share/doc/qt6/qtlocation/qgeocodingmanager-members.html
/usr/share/doc/qt6/qtlocation/qgeocodingmanager.html
/usr/share/doc/qt6/qtlocation/qgeocodingmanagerengine-members.html
/usr/share/doc/qt6/qtlocation/qgeocodingmanagerengine.html
/usr/share/doc/qt6/qtlocation/qgeojson.html
/usr/share/doc/qt6/qtlocation/qgeomaneuver-members.html
/usr/share/doc/qt6/qtlocation/qgeomaneuver.html
/usr/share/doc/qt6/qtlocation/qgeoroute-members.html
/usr/share/doc/qt6/qtlocation/qgeoroute.html
/usr/share/doc/qt6/qtlocation/qgeoroutereply-members.html
/usr/share/doc/qt6/qtlocation/qgeoroutereply.html
/usr/share/doc/qt6/qtlocation/qgeorouterequest-members.html
/usr/share/doc/qt6/qtlocation/qgeorouterequest.html
/usr/share/doc/qt6/qtlocation/qgeoroutesegment-members.html
/usr/share/doc/qt6/qtlocation/qgeoroutesegment.html
/usr/share/doc/qt6/qtlocation/qgeoroutingmanager-members.html
/usr/share/doc/qt6/qtlocation/qgeoroutingmanager.html
/usr/share/doc/qt6/qtlocation/qgeoroutingmanagerengine-members.html
/usr/share/doc/qt6/qtlocation/qgeoroutingmanagerengine.html
/usr/share/doc/qt6/qtlocation/qgeoserviceprovider-members.html
/usr/share/doc/qt6/qtlocation/qgeoserviceprovider.html
/usr/share/doc/qt6/qtlocation/qgeoserviceproviderfactory-members.html
/usr/share/doc/qt6/qtlocation/qgeoserviceproviderfactory.html
/usr/share/doc/qt6/qtlocation/qlocation.html
/usr/share/doc/qt6/qtlocation/qml-cameracapabilities.html
/usr/share/doc/qt6/qtlocation/qml-contactdetail.html
/usr/share/doc/qt6/qtlocation/qml-icon.html
/usr/share/doc/qt6/qtlocation/qml-location5-maps.html
/usr/share/doc/qt6/qtlocation/qml-placeattribute.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-category-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-category.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-categorymodel-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-categorymodel.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-contactdetails-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-contactdetails.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-editorialmodel-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-editorialmodel.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-extendedattributes-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-extendedattributes.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-geocodemodel-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-geocodemodel.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-imagemodel-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-imagemodel.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-map-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-map.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-mapcircle-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-mapcircle.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-mapcopyrightnotice-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-mapcopyrightnotice.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-mapitemgroup-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-mapitemgroup.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-mapitemview-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-mapitemview.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-mappolygon-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-mappolygon.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-mappolyline-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-mappolyline.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-mapquickitem-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-mapquickitem.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-maprectangle-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-maprectangle.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-maproute-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-maproute.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-maptype-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-maptype.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-mapview-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-mapview.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-place-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-place.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-placesearchmodel-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-placesearchmodel.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-placesearchsuggestionmodel-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-placesearchsuggestionmodel.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-plugin-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-plugin.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-pluginparameter-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-pluginparameter.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-reviewmodel-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-reviewmodel.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-routemaneuver-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-routemaneuver.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-routemodel-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-routemodel.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-routequery-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-routequery.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-routesegment-members.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation-routesegment.html
/usr/share/doc/qt6/qtlocation/qml-qtlocation5-maps.html
/usr/share/doc/qt6/qtlocation/qml-ratings.html
/usr/share/doc/qt6/qtlocation/qml-route.html
/usr/share/doc/qt6/qtlocation/qml-supplier.html
/usr/share/doc/qt6/qtlocation/qml-user.html
/usr/share/doc/qt6/qtlocation/qplace-members.html
/usr/share/doc/qt6/qtlocation/qplace.html
/usr/share/doc/qt6/qtlocation/qplaceattribute-members.html
/usr/share/doc/qt6/qtlocation/qplaceattribute.html
/usr/share/doc/qt6/qtlocation/qplacecategory-members.html
/usr/share/doc/qt6/qtlocation/qplacecategory.html
/usr/share/doc/qt6/qtlocation/qplacecontactdetail-members.html
/usr/share/doc/qt6/qtlocation/qplacecontactdetail.html
/usr/share/doc/qt6/qtlocation/qplacecontent-members.html
/usr/share/doc/qt6/qtlocation/qplacecontent.html
/usr/share/doc/qt6/qtlocation/qplacecontentreply-members.html
/usr/share/doc/qt6/qtlocation/qplacecontentreply.html
/usr/share/doc/qt6/qtlocation/qplacecontentrequest-members.html
/usr/share/doc/qt6/qtlocation/qplacecontentrequest.html
/usr/share/doc/qt6/qtlocation/qplacedetailsreply-members.html
/usr/share/doc/qt6/qtlocation/qplacedetailsreply.html
/usr/share/doc/qt6/qtlocation/qplaceicon-members.html
/usr/share/doc/qt6/qtlocation/qplaceicon.html
/usr/share/doc/qt6/qtlocation/qplaceidreply-members.html
/usr/share/doc/qt6/qtlocation/qplaceidreply.html
/usr/share/doc/qt6/qtlocation/qplacemanager-members.html
/usr/share/doc/qt6/qtlocation/qplacemanager.html
/usr/share/doc/qt6/qtlocation/qplacemanagerengine-members.html
/usr/share/doc/qt6/qtlocation/qplacemanagerengine.html
/usr/share/doc/qt6/qtlocation/qplacematchreply-members.html
/usr/share/doc/qt6/qtlocation/qplacematchreply.html
/usr/share/doc/qt6/qtlocation/qplacematchrequest-members.html
/usr/share/doc/qt6/qtlocation/qplacematchrequest.html
/usr/share/doc/qt6/qtlocation/qplaceproposedsearchresult-members.html
/usr/share/doc/qt6/qtlocation/qplaceproposedsearchresult.html
/usr/share/doc/qt6/qtlocation/qplaceratings-members.html
/usr/share/doc/qt6/qtlocation/qplaceratings.html
/usr/share/doc/qt6/qtlocation/qplacereply-members.html
/usr/share/doc/qt6/qtlocation/qplacereply.html
/usr/share/doc/qt6/qtlocation/qplaceresult-members.html
/usr/share/doc/qt6/qtlocation/qplaceresult.html
/usr/share/doc/qt6/qtlocation/qplacesearchreply-members.html
/usr/share/doc/qt6/qtlocation/qplacesearchreply.html
/usr/share/doc/qt6/qtlocation/qplacesearchrequest-members.html
/usr/share/doc/qt6/qtlocation/qplacesearchrequest.html
/usr/share/doc/qt6/qtlocation/qplacesearchresult-members.html
/usr/share/doc/qt6/qtlocation/qplacesearchresult.html
/usr/share/doc/qt6/qtlocation/qplacesearchsuggestionreply-members.html
/usr/share/doc/qt6/qtlocation/qplacesearchsuggestionreply.html
/usr/share/doc/qt6/qtlocation/qplacesupplier-members.html
/usr/share/doc/qt6/qtlocation/qplacesupplier.html
/usr/share/doc/qt6/qtlocation/qplaceuser-members.html
/usr/share/doc/qt6/qtlocation/qplaceuser.html
/usr/share/doc/qt6/qtlocation/qtlocation-changes-qt6.html
/usr/share/doc/qt6/qtlocation/qtlocation-cpp.html
/usr/share/doc/qt6/qtlocation/qtlocation-examples.html
/usr/share/doc/qt6/qtlocation/qtlocation-geojson-viewer-example.html
/usr/share/doc/qt6/qtlocation/qtlocation-geoservices.html
/usr/share/doc/qt6/qtlocation/qtlocation-index.html
/usr/share/doc/qt6/qtlocation/qtlocation-itemview-transitions-example.html
/usr/share/doc/qt6/qtlocation/qtlocation-mapviewer-example.html
/usr/share/doc/qt6/qtlocation/qtlocation-minimal-map-example.html
/usr/share/doc/qt6/qtlocation/qtlocation-module.html
/usr/share/doc/qt6/qtlocation/qtlocation-places-example.html
/usr/share/doc/qt6/qtlocation/qtlocation-places-list-example.html
/usr/share/doc/qt6/qtlocation/qtlocation-places-map-example.html
/usr/share/doc/qt6/qtlocation/qtlocation-planespotter-example.html
/usr/share/doc/qt6/qtlocation/qtlocation-qmlmodule.html
/usr/share/doc/qt6/qtlocation/qtlocation.index
/usr/share/doc/qt6/qtlocation/qtlocation.qhp
/usr/share/doc/qt6/qtlocation/qtlocation.qhp.sha1
/usr/share/doc/qt6/qtlocation/style
/usr/share/doc/qt6/qtlocation/style/offline-dark.css
/usr/share/doc/qt6/qtlocation/style/offline-simple.css
/usr/share/doc/qt6/qtlocation/style/offline.css
/usr/share/doc/qt6/qtlottieanimation/images
/usr/share/doc/qt6/qtlottieanimation/images/arrow_bc.png
/usr/share/doc/qt6/qtlottieanimation/images/bgrContent.png
/usr/share/doc/qt6/qtlottieanimation/images/btn_next.png
/usr/share/doc/qt6/qtlottieanimation/images/btn_prev.png
/usr/share/doc/qt6/qtlottieanimation/images/bullet_dn.png
/usr/share/doc/qt6/qtlottieanimation/images/bullet_sq.png
/usr/share/doc/qt6/qtlottieanimation/images/home.png
/usr/share/doc/qt6/qtlottieanimation/images/ico_note.png
/usr/share/doc/qt6/qtlottieanimation/images/ico_note_attention.png
/usr/share/doc/qt6/qtlottieanimation/images/ico_out.png
/usr/share/doc/qt6/qtlottieanimation/images/logo.png
/usr/share/doc/qt6/qtlottieanimation/qml-qt-labs-lottieqt-lottieanimation-members.html
/usr/share/doc/qt6/qtlottieanimation/qml-qt-labs-lottieqt-lottieanimation.html
/usr/share/doc/qt6/qtlottieanimation/qt-labs-lottieqt-qmlmodule.html
/usr/share/doc/qt6/qtlottieanimation/qtlottieanimation-index.html
/usr/share/doc/qt6/qtlottieanimation/qtlottieanimation.index
/usr/share/doc/qt6/qtlottieanimation/qtlottieanimation.qhp
/usr/share/doc/qt6/qtlottieanimation/qtlottieanimation.qhp.sha1
/usr/share/doc/qt6/qtlottieanimation/style
/usr/share/doc/qt6/qtlottieanimation/style/offline-dark.css
/usr/share/doc/qt6/qtlottieanimation/style/offline-simple.css
/usr/share/doc/qt6/qtlottieanimation/style/offline.css
/usr/share/doc/qt6/qtmqtt/examples-manifest.xml
/usr/share/doc/qt6/qtmqtt/images
/usr/share/doc/qt6/qtmqtt/images/arrow_bc.png
/usr/share/doc/qt6/qtmqtt/images/bgrContent.png
/usr/share/doc/qt6/qtmqtt/images/btn_next.png
/usr/share/doc/qt6/qtmqtt/images/btn_prev.png
/usr/share/doc/qt6/qtmqtt/images/bullet_dn.png
/usr/share/doc/qt6/qtmqtt/images/bullet_sq.png
/usr/share/doc/qt6/qtmqtt/images/home.png
/usr/share/doc/qt6/qtmqtt/images/ico_note.png
/usr/share/doc/qt6/qtmqtt/images/ico_note_attention.png
/usr/share/doc/qt6/qtmqtt/images/ico_out.png
/usr/share/doc/qt6/qtmqtt/images/logo.png
/usr/share/doc/qt6/qtmqtt/images/mqtt.png
/usr/share/doc/qt6/qtmqtt/images/quickpublication.png
/usr/share/doc/qt6/qtmqtt/images/quicksubscription.png
/usr/share/doc/qt6/qtmqtt/images/simpleclient.png
/usr/share/doc/qt6/qtmqtt/images/subscriptions.png
/usr/share/doc/qt6/qtmqtt/qhash-qtmqtt-proxy.html
/usr/share/doc/qt6/qtmqtt/qmqtt.html
/usr/share/doc/qt6/qtmqtt/qmqttauthenticationproperties-members.html
/usr/share/doc/qt6/qtmqtt/qmqttauthenticationproperties.html
/usr/share/doc/qt6/qtmqtt/qmqttclient-members.html
/usr/share/doc/qt6/qtmqtt/qmqttclient.html
/usr/share/doc/qt6/qtmqtt/qmqttconnectionproperties-members.html
/usr/share/doc/qt6/qtmqtt/qmqttconnectionproperties.html
/usr/share/doc/qt6/qtmqtt/qmqttlastwillproperties-members.html
/usr/share/doc/qt6/qtmqtt/qmqttlastwillproperties.html
/usr/share/doc/qt6/qtmqtt/qmqttmessage-members.html
/usr/share/doc/qt6/qtmqtt/qmqttmessage.html
/usr/share/doc/qt6/qtmqtt/qmqttmessagestatusproperties-members.html
/usr/share/doc/qt6/qtmqtt/qmqttmessagestatusproperties.html
/usr/share/doc/qt6/qtmqtt/qmqttpublishproperties-members.html
/usr/share/doc/qt6/qtmqtt/qmqttpublishproperties.html
/usr/share/doc/qt6/qtmqtt/qmqttserverconnectionproperties-members.html
/usr/share/doc/qt6/qtmqtt/qmqttserverconnectionproperties.html
/usr/share/doc/qt6/qtmqtt/qmqttstringpair-members.html
/usr/share/doc/qt6/qtmqtt/qmqttstringpair.html
/usr/share/doc/qt6/qtmqtt/qmqttsubscription-members.html
/usr/share/doc/qt6/qtmqtt/qmqttsubscription.html
/usr/share/doc/qt6/qtmqtt/qmqttsubscriptionproperties-members.html
/usr/share/doc/qt6/qtmqtt/qmqttsubscriptionproperties.html
/usr/share/doc/qt6/qtmqtt/qmqtttopicfilter-members.html
/usr/share/doc/qt6/qtmqtt/qmqtttopicfilter.html
/usr/share/doc/qt6/qtmqtt/qmqtttopicname-members.html
/usr/share/doc/qt6/qtmqtt/qmqtttopicname.html
/usr/share/doc/qt6/qtmqtt/qmqttunsubscriptionproperties-members.html
/usr/share/doc/qt6/qtmqtt/qmqttunsubscriptionproperties.html
/usr/share/doc/qt6/qtmqtt/qmqttuserproperties-members.html
/usr/share/doc/qt6/qtmqtt/qmqttuserproperties.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-examples.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-index.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-module.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-overview.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-quickpublication-cmakelists-txt.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-quickpublication-example.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-quickpublication-main-cpp.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-quickpublication-main-qml.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-quickpublication-qmldir.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-quickpublication-qmlmqttclient-cpp.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-quickpublication-qmlmqttclient-h.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-quickpublication-quickpublication-pro.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-quicksubscription-cmakelists-txt.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-quicksubscription-example.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-quicksubscription-main-cpp.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-quicksubscription-main-qml.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-quicksubscription-qmldir.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-quicksubscription-qmlmqttclient-cpp.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-quicksubscription-qmlmqttclient-h.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-quicksubscription-quicksubscription-pro.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-simpleclient-cmakelists-txt.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-simpleclient-example.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-simpleclient-main-cpp.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-simpleclient-mainwindow-cpp.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-simpleclient-mainwindow-h.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-simpleclient-mainwindow-ui.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-simpleclient-simpleclient-pro.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-subscriptions-cmakelists-txt.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-subscriptions-example.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-subscriptions-main-cpp.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-subscriptions-mainwindow-cpp.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-subscriptions-mainwindow-h.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-subscriptions-mainwindow-ui.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-subscriptions-subscriptions-pro.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-subscriptions-subscriptionwindow-cpp.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-subscriptions-subscriptionwindow-h.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-subscriptions-subscriptionwindow-ui.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-websocketsubscription-clientsubscription-cpp.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-websocketsubscription-clientsubscription-h.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-websocketsubscription-cmakelists-txt.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-websocketsubscription-example.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-websocketsubscription-main-cpp.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-websocketsubscription-websocketiodevice-cpp.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-websocketsubscription-websocketiodevice-h.html
/usr/share/doc/qt6/qtmqtt/qtmqtt-websocketsubscription-websocketsubscription-pro.html
/usr/share/doc/qt6/qtmqtt/qtmqtt.index
/usr/share/doc/qt6/qtmqtt/qtmqtt.qhp
/usr/share/doc/qt6/qtmqtt/qtmqtt.qhp.sha1
/usr/share/doc/qt6/qtmqtt/style
/usr/share/doc/qt6/qtmqtt/style/offline-dark.css
/usr/share/doc/qt6/qtmqtt/style/offline-simple.css
/usr/share/doc/qt6/qtmqtt/style/offline.css
/usr/share/doc/qt6/qtmultimedia/audiooverview.html
/usr/share/doc/qt6/qtmultimedia/cameraoverview.html
/usr/share/doc/qt6/qtmultimedia/examples-manifest.xml
/usr/share/doc/qt6/qtmultimedia/images
/usr/share/doc/qt6/qtmultimedia/images/CaptureControls.png
/usr/share/doc/qt6/qtmultimedia/images/FlashControls.png
/usr/share/doc/qt6/qtmultimedia/images/OqosZsDqvzQ.jpg
/usr/share/doc/qt6/qtmultimedia/images/PlayerMenuBar.gif
/usr/share/doc/qt6/qtmultimedia/images/VideoCaptureControls.png
/usr/share/doc/qt6/qtmultimedia/images/Zoom.gif
/usr/share/doc/qt6/qtmultimedia/images/ZoomControl.png
/usr/share/doc/qt6/qtmultimedia/images/architecture-overview.gif
/usr/share/doc/qt6/qtmultimedia/images/arrow_bc.png
/usr/share/doc/qt6/qtmultimedia/images/audio-control.gif
/usr/share/doc/qt6/qtmultimedia/images/audiodevices.png
/usr/share/doc/qt6/qtmultimedia/images/audiooutput-example.png
/usr/share/doc/qt6/qtmultimedia/images/audiorecorder.png
/usr/share/doc/qt6/qtmultimedia/images/audiosource-example.png
/usr/share/doc/qt6/qtmultimedia/images/bgrContent.png
/usr/share/doc/qt6/qtmultimedia/images/btn_next.png
/usr/share/doc/qt6/qtmultimedia/images/btn_prev.png
/usr/share/doc/qt6/qtmultimedia/images/bullet_dn.png
/usr/share/doc/qt6/qtmultimedia/images/bullet_sq.png
/usr/share/doc/qt6/qtmultimedia/images/camera-example.png
/usr/share/doc/qt6/qtmultimedia/images/home.png
/usr/share/doc/qt6/qtmultimedia/images/how-focus-works.gif
/usr/share/doc/qt6/qtmultimedia/images/ico_note.png
/usr/share/doc/qt6/qtmultimedia/images/ico_note_attention.png
/usr/share/doc/qt6/qtmultimedia/images/ico_out.png
/usr/share/doc/qt6/qtmultimedia/images/image_processing.png
/usr/share/doc/qt6/qtmultimedia/images/logo.png
/usr/share/doc/qt6/qtmultimedia/images/mediaplayerex.jpg
/usr/share/doc/qt6/qtmultimedia/images/meta-data.png
/usr/share/doc/qt6/qtmultimedia/images/nHrBbW0H-pc.jpg
/usr/share/doc/qt6/qtmultimedia/images/noun_Media_166644.svg
/usr/share/doc/qt6/qtmultimedia/images/play-pause-stop.gif
/usr/share/doc/qt6/qtmultimedia/images/playbackControlPanel.gif
/usr/share/doc/qt6/qtmultimedia/images/qml-camera.png
/usr/share/doc/qt6/qtmultimedia/images/qml-declarative-portrait.png
/usr/share/doc/qt6/qtmultimedia/images/qml-recorder-control-bar-overview.gif
/usr/share/doc/qt6/qtmultimedia/images/qml-recorder-overview.gif
/usr/share/doc/qt6/qtmultimedia/images/qmlmediaplayer.jpg
/usr/share/doc/qt6/qtmultimedia/images/qmlrecorder.jpg
/usr/share/doc/qt6/qtmultimedia/images/qmlvideo-menu.jpg
/usr/share/doc/qt6/qtmultimedia/images/qmlvideo-overlay.jpg
/usr/share/doc/qt6/qtmultimedia/images/screencapture.jpg
/usr/share/doc/qt6/qtmultimedia/images/sf_yv01UtIw.jpg
/usr/share/doc/qt6/qtmultimedia/images/sound-wave-small.jpg
/usr/share/doc/qt6/qtmultimedia/images/spectrum-demo.png
/usr/share/doc/qt6/qtmultimedia/images/url.png
/usr/share/doc/qt6/qtmultimedia/images/video-qml-paint-rate.png
/usr/share/doc/qt6/qtmultimedia/images/video-videographicsitem.png
/usr/share/doc/qt6/qtmultimedia/images/video-videowidget.png
/usr/share/doc/qt6/qtmultimedia/multimedia-examples.html
/usr/share/doc/qt6/qtmultimedia/multimediaoverview.html
/usr/share/doc/qt6/qtmultimedia/qaudio.html
/usr/share/doc/qt6/qtmultimedia/qaudiobuffer-members.html
/usr/share/doc/qt6/qtmultimedia/qaudiobuffer.html
/usr/share/doc/qt6/qtmultimedia/qaudiodecoder-members.html
/usr/share/doc/qt6/qtmultimedia/qaudiodecoder.html
/usr/share/doc/qt6/qtmultimedia/qaudiodevice-members.html
/usr/share/doc/qt6/qtmultimedia/qaudiodevice.html
/usr/share/doc/qt6/qtmultimedia/qaudioformat-members.html
/usr/share/doc/qt6/qtmultimedia/qaudioformat.html
/usr/share/doc/qt6/qtmultimedia/qaudioinput-members.html
/usr/share/doc/qt6/qtmultimedia/qaudioinput.html
/usr/share/doc/qt6/qtmultimedia/qaudiooutput-members.html
/usr/share/doc/qt6/qtmultimedia/qaudiooutput.html
/usr/share/doc/qt6/qtmultimedia/qaudiosink-members.html
/usr/share/doc/qt6/qtmultimedia/qaudiosink.html
/usr/share/doc/qt6/qtmultimedia/qaudiosource-members.html
/usr/share/doc/qt6/qtmultimedia/qaudiosource.html
/usr/share/doc/qt6/qtmultimedia/qcamera-members.html
/usr/share/doc/qt6/qtmultimedia/qcamera.html
/usr/share/doc/qt6/qtmultimedia/qcameradevice-members.html
/usr/share/doc/qt6/qtmultimedia/qcameradevice.html
/usr/share/doc/qt6/qtmultimedia/qcameraformat-members.html
/usr/share/doc/qt6/qtmultimedia/qcameraformat.html
/usr/share/doc/qt6/qtmultimedia/qcapturablewindow-members.html
/usr/share/doc/qt6/qtmultimedia/qcapturablewindow.html
/usr/share/doc/qt6/qtmultimedia/qgraphicsvideoitem-members.html
/usr/share/doc/qt6/qtmultimedia/qgraphicsvideoitem.html
/usr/share/doc/qt6/qtmultimedia/qimagecapture-members.html
/usr/share/doc/qt6/qtmultimedia/qimagecapture.html
/usr/share/doc/qt6/qtmultimedia/qmediacapturesession-members.html
/usr/share/doc/qt6/qtmultimedia/qmediacapturesession.html
/usr/share/doc/qt6/qtmultimedia/qmediadevices-members.html
/usr/share/doc/qt6/qtmultimedia/qmediadevices.html
/usr/share/doc/qt6/qtmultimedia/qmediaformat-members.html
/usr/share/doc/qt6/qtmultimedia/qmediaformat.html
/usr/share/doc/qt6/qtmultimedia/qmediametadata-members.html
/usr/share/doc/qt6/qtmultimedia/qmediametadata.html
/usr/share/doc/qt6/qtmultimedia/qmediaplayer-members.html
/usr/share/doc/qt6/qtmultimedia/qmediaplayer.html
/usr/share/doc/qt6/qtmultimedia/qmediarecorder-members.html
/usr/share/doc/qt6/qtmultimedia/qmediarecorder.html
/usr/share/doc/qt6/qtmultimedia/qmediatimerange-interval-members.html
/usr/share/doc/qt6/qtmultimedia/qmediatimerange-interval.html
/usr/share/doc/qt6/qtmultimedia/qmediatimerange-members.html
/usr/share/doc/qt6/qtmultimedia/qmediatimerange.html
/usr/share/doc/qt6/qtmultimedia/qml-audiodevice.html
/usr/share/doc/qt6/qtmultimedia/qml-cameradevice.html
/usr/share/doc/qt6/qtmultimedia/qml-cameraformat.html
/usr/share/doc/qt6/qtmultimedia/qml-capturablewindow.html
/usr/share/doc/qt6/qtmultimedia/qml-mediaformat.html
/usr/share/doc/qt6/qtmultimedia/qml-mediametadata.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-audioinput-members.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-audioinput.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-audiooutput-members.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-audiooutput.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-camera-members.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-camera.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-capturesession-members.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-capturesession.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-imagecapture-members.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-imagecapture.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-mediadevices-members.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-mediadevices.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-mediaplayer-members.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-mediaplayer.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-mediarecorder-members.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-mediarecorder.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-screencapture-members.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-screencapture.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-soundeffect-members.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-soundeffect.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-video-members.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-video.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-videooutput-members.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-videooutput.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-windowcapture-members.html
/usr/share/doc/qt6/qtmultimedia/qml-qtmultimedia-windowcapture.html
/usr/share/doc/qt6/qtmultimedia/qscreencapture-members.html
/usr/share/doc/qt6/qtmultimedia/qscreencapture.html
/usr/share/doc/qt6/qtmultimedia/qsoundeffect-members.html
/usr/share/doc/qt6/qtmultimedia/qsoundeffect.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia-apple.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia-attribution-ffmpeg-boost.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia-attribution-ffmpeg-libjpeg.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia-attribution-ffmpeg-zlib.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia-attribution-ffmpeg.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia-audiodevices-example.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia-audiooutput-example.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia-audiorecorder-example.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia-audiosource-example.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia-camera-example.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia-changes-qt6.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia-declarative-camera-example.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia-index.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia-module.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia-modules.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia-player-example.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia-qmlmodule.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia-screencapture-example.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia-spectrum-example.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia-video-mediaplayer-example.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia-video-qmlvideo-example.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia-video-recorder-example.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia-videographicsitem-example.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia-videowidget-example.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia-wasm.html
/usr/share/doc/qt6/qtmultimedia/qtmultimedia.index
/usr/share/doc/qt6/qtmultimedia/qtmultimedia.qhp
/usr/share/doc/qt6/qtmultimedia/qtmultimedia.qhp.sha1
/usr/share/doc/qt6/qtmultimedia/qtmultimediawidgets-index.html
/usr/share/doc/qt6/qtmultimedia/qtmultimediawidgets-module.html
/usr/share/doc/qt6/qtmultimedia/qvideoframe-members.html
/usr/share/doc/qt6/qtmultimedia/qvideoframe.html
/usr/share/doc/qt6/qtmultimedia/qvideoframeformat-members.html
/usr/share/doc/qt6/qtmultimedia/qvideoframeformat-obsolete.html
/usr/share/doc/qt6/qtmultimedia/qvideoframeformat.html
/usr/share/doc/qt6/qtmultimedia/qvideosink-members.html
/usr/share/doc/qt6/qtmultimedia/qvideosink.html
/usr/share/doc/qt6/qtmultimedia/qvideowidget-members.html
/usr/share/doc/qt6/qtmultimedia/qvideowidget.html
/usr/share/doc/qt6/qtmultimedia/qwindowcapture-members.html
/usr/share/doc/qt6/qtmultimedia/qwindowcapture.html
/usr/share/doc/qt6/qtmultimedia/style
/usr/share/doc/qt6/qtmultimedia/style/offline-dark.css
/usr/share/doc/qt6/qtmultimedia/style/offline-simple.css
/usr/share/doc/qt6/qtmultimedia/style/offline.css
/usr/share/doc/qt6/qtmultimedia/videooverview.html
/usr/share/doc/qt6/qtnetwork/examples-manifest.xml
/usr/share/doc/qt6/qtnetwork/examples-network.html
/usr/share/doc/qt6/qtnetwork/images
/usr/share/doc/qt6/qtnetwork/images/arrow_bc.png
/usr/share/doc/qt6/qtnetwork/images/bgrContent.png
/usr/share/doc/qt6/qtnetwork/images/blockingfortuneclient-example.png
/usr/share/doc/qt6/qtnetwork/images/broadcastreceiver-example.png
/usr/share/doc/qt6/qtnetwork/images/broadcastsender-example.png
/usr/share/doc/qt6/qtnetwork/images/btn_next.png
/usr/share/doc/qt6/qtnetwork/images/btn_prev.png
/usr/share/doc/qt6/qtnetwork/images/bullet_dn.png
/usr/share/doc/qt6/qtnetwork/images/bullet_sq.png
/usr/share/doc/qt6/qtnetwork/images/fortuneclient-example.png
/usr/share/doc/qt6/qtnetwork/images/fortuneserver-example.png
/usr/share/doc/qt6/qtnetwork/images/home.png
/usr/share/doc/qt6/qtnetwork/images/http-example.webp
/usr/share/doc/qt6/qtnetwork/images/ico_note.png
/usr/share/doc/qt6/qtnetwork/images/ico_note_attention.png
/usr/share/doc/qt6/qtnetwork/images/ico_out.png
/usr/share/doc/qt6/qtnetwork/images/logo.png
/usr/share/doc/qt6/qtnetwork/images/multicastreceiver-example.webp
/usr/share/doc/qt6/qtnetwork/images/multicastsender-example.webp
/usr/share/doc/qt6/qtnetwork/images/network-chat-example.png
/usr/share/doc/qt6/qtnetwork/images/network-examples.webp
/usr/share/doc/qt6/qtnetwork/images/rsslisting.png
/usr/share/doc/qt6/qtnetwork/images/securesocketclient.png
/usr/share/doc/qt6/qtnetwork/images/securesocketclient2.png
/usr/share/doc/qt6/qtnetwork/images/secureudpclient-example.png
/usr/share/doc/qt6/qtnetwork/images/secureudpserver-example.png
/usr/share/doc/qt6/qtnetwork/images/tcpstream.png
/usr/share/doc/qt6/qtnetwork/images/threadedfortuneserver-example.png
/usr/share/doc/qt6/qtnetwork/images/torrent-example.png
/usr/share/doc/qt6/qtnetwork/images/udppackets.png
/usr/share/doc/qt6/qtnetwork/network-changes-qt6.html
/usr/share/doc/qt6/qtnetwork/network.html
/usr/share/doc/qt6/qtnetwork/qabstractnetworkcache-members.html
/usr/share/doc/qt6/qtnetwork/qabstractnetworkcache.html
/usr/share/doc/qt6/qtnetwork/qabstractsocket-members.html
/usr/share/doc/qt6/qtnetwork/qabstractsocket.html
/usr/share/doc/qt6/qtnetwork/qauthenticator-members.html
/usr/share/doc/qt6/qtnetwork/qauthenticator.html
/usr/share/doc/qt6/qtnetwork/qdnsdomainnamerecord-members.html
/usr/share/doc/qt6/qtnetwork/qdnsdomainnamerecord.html
/usr/share/doc/qt6/qtnetwork/qdnshostaddressrecord-members.html
/usr/share/doc/qt6/qtnetwork/qdnshostaddressrecord.html
/usr/share/doc/qt6/qtnetwork/qdnslookup-members.html
/usr/share/doc/qt6/qtnetwork/qdnslookup.html
/usr/share/doc/qt6/qtnetwork/qdnsmailexchangerecord-members.html
/usr/share/doc/qt6/qtnetwork/qdnsmailexchangerecord.html
/usr/share/doc/qt6/qtnetwork/qdnsservicerecord-members.html
/usr/share/doc/qt6/qtnetwork/qdnsservicerecord.html
/usr/share/doc/qt6/qtnetwork/qdnstextrecord-members.html
/usr/share/doc/qt6/qtnetwork/qdnstextrecord.html
/usr/share/doc/qt6/qtnetwork/qdtls-members.html
/usr/share/doc/qt6/qtnetwork/qdtls.html
/usr/share/doc/qt6/qtnetwork/qdtlsclientverifier-generatorparameters-members.html
/usr/share/doc/qt6/qtnetwork/qdtlsclientverifier-generatorparameters.html
/usr/share/doc/qt6/qtnetwork/qdtlsclientverifier-members.html
/usr/share/doc/qt6/qtnetwork/qdtlsclientverifier.html
/usr/share/doc/qt6/qtnetwork/qhash-qtnetwork-proxy.html
/usr/share/doc/qt6/qtnetwork/qhostaddress-members.html
/usr/share/doc/qt6/qtnetwork/qhostaddress.html
/usr/share/doc/qt6/qtnetwork/qhostinfo-members.html
/usr/share/doc/qt6/qtnetwork/qhostinfo.html
/usr/share/doc/qt6/qtnetwork/qhstspolicy-members.html
/usr/share/doc/qt6/qtnetwork/qhstspolicy.html
/usr/share/doc/qt6/qtnetwork/qhttp1configuration-members.html
/usr/share/doc/qt6/qtnetwork/qhttp1configuration.html
/usr/share/doc/qt6/qtnetwork/qhttp2configuration-members.html
/usr/share/doc/qt6/qtnetwork/qhttp2configuration.html
/usr/share/doc/qt6/qtnetwork/qhttpmultipart-members.html
/usr/share/doc/qt6/qtnetwork/qhttpmultipart.html
/usr/share/doc/qt6/qtnetwork/qhttppart-members.html
/usr/share/doc/qt6/qtnetwork/qhttppart.html
/usr/share/doc/qt6/qtnetwork/qlocalserver-members.html
/usr/share/doc/qt6/qtnetwork/qlocalserver.html
/usr/share/doc/qt6/qtnetwork/qlocalsocket-members.html
/usr/share/doc/qt6/qtnetwork/qlocalsocket.html
/usr/share/doc/qt6/qtnetwork/qnetworkaccessmanager-members.html
/usr/share/doc/qt6/qtnetwork/qnetworkaccessmanager-obsolete.html
/usr/share/doc/qt6/qtnetwork/qnetworkaccessmanager.html
/usr/share/doc/qt6/qtnetwork/qnetworkaddressentry-members.html
/usr/share/doc/qt6/qtnetwork/qnetworkaddressentry.html
/usr/share/doc/qt6/qtnetwork/qnetworkcachemetadata-members.html
/usr/share/doc/qt6/qtnetwork/qnetworkcachemetadata.html
/usr/share/doc/qt6/qtnetwork/qnetworkcookie-members.html
/usr/share/doc/qt6/qtnetwork/qnetworkcookie.html
/usr/share/doc/qt6/qtnetwork/qnetworkcookiejar-members.html
/usr/share/doc/qt6/qtnetwork/qnetworkcookiejar.html
/usr/share/doc/qt6/qtnetwork/qnetworkdatagram-members.html
/usr/share/doc/qt6/qtnetwork/qnetworkdatagram.html
/usr/share/doc/qt6/qtnetwork/qnetworkdiskcache-members.html
/usr/share/doc/qt6/qtnetwork/qnetworkdiskcache.html
/usr/share/doc/qt6/qtnetwork/qnetworkinformation-members.html
/usr/share/doc/qt6/qtnetwork/qnetworkinformation-obsolete.html
/usr/share/doc/qt6/qtnetwork/qnetworkinformation.html
/usr/share/doc/qt6/qtnetwork/qnetworkinterface-members.html
/usr/share/doc/qt6/qtnetwork/qnetworkinterface.html
/usr/share/doc/qt6/qtnetwork/qnetworkproxy-members.html
/usr/share/doc/qt6/qtnetwork/qnetworkproxy.html
/usr/share/doc/qt6/qtnetwork/qnetworkproxyfactory-members.html
/usr/share/doc/qt6/qtnetwork/qnetworkproxyfactory.html
/usr/share/doc/qt6/qtnetwork/qnetworkproxyquery-members.html
/usr/share/doc/qt6/qtnetwork/qnetworkproxyquery.html
/usr/share/doc/qt6/qtnetwork/qnetworkreply-members.html
/usr/share/doc/qt6/qtnetwork/qnetworkreply.html
/usr/share/doc/qt6/qtnetwork/qnetworkrequest-members.html
/usr/share/doc/qt6/qtnetwork/qnetworkrequest.html
/usr/share/doc/qt6/qtnetwork/qocspresponse-members.html
/usr/share/doc/qt6/qtnetwork/qocspresponse.html
/usr/share/doc/qt6/qtnetwork/qpassworddigestor.html
/usr/share/doc/qt6/qtnetwork/qsctpserver-members.html
/usr/share/doc/qt6/qtnetwork/qsctpserver.html
/usr/share/doc/qt6/qtnetwork/qsctpsocket-members.html
/usr/share/doc/qt6/qtnetwork/qsctpsocket.html
/usr/share/doc/qt6/qtnetwork/qssl.html
/usr/share/doc/qt6/qtnetwork/qsslcertificate-members.html
/usr/share/doc/qt6/qtnetwork/qsslcertificate.html
/usr/share/doc/qt6/qtnetwork/qsslcertificateextension-members.html
/usr/share/doc/qt6/qtnetwork/qsslcertificateextension.html
/usr/share/doc/qt6/qtnetwork/qsslcipher-members.html
/usr/share/doc/qt6/qtnetwork/qsslcipher.html
/usr/share/doc/qt6/qtnetwork/qsslconfiguration-members.html
/usr/share/doc/qt6/qtnetwork/qsslconfiguration.html
/usr/share/doc/qt6/qtnetwork/qssldiffiehellmanparameters-members.html
/usr/share/doc/qt6/qtnetwork/qssldiffiehellmanparameters.html
/usr/share/doc/qt6/qtnetwork/qsslellipticcurve-members.html
/usr/share/doc/qt6/qtnetwork/qsslellipticcurve.html
/usr/share/doc/qt6/qtnetwork/qsslerror-members.html
/usr/share/doc/qt6/qtnetwork/qsslerror.html
/usr/share/doc/qt6/qtnetwork/qsslkey-members.html
/usr/share/doc/qt6/qtnetwork/qsslkey.html
/usr/share/doc/qt6/qtnetwork/qsslpresharedkeyauthenticator-members.html
/usr/share/doc/qt6/qtnetwork/qsslpresharedkeyauthenticator.html
/usr/share/doc/qt6/qtnetwork/qsslserver-members.html
/usr/share/doc/qt6/qtnetwork/qsslserver.html
/usr/share/doc/qt6/qtnetwork/qsslsocket-members.html
/usr/share/doc/qt6/qtnetwork/qsslsocket.html
/usr/share/doc/qt6/qtnetwork/qtcpserver-members.html
/usr/share/doc/qt6/qtnetwork/qtcpserver.html
/usr/share/doc/qt6/qtnetwork/qtcpsocket-members.html
/usr/share/doc/qt6/qtnetwork/qtcpsocket.html
/usr/share/doc/qt6/qtnetwork/qtnetwork-attribution-libpsl.html
/usr/share/doc/qt6/qtnetwork/qtnetwork-attribution-psl-data.html
/usr/share/doc/qt6/qtnetwork/qtnetwork-blockingfortuneclient-example.html
/usr/share/doc/qt6/qtnetwork/qtnetwork-broadcastreceiver-example.html
/usr/share/doc/qt6/qtnetwork/qtnetwork-broadcastsender-example.html
/usr/share/doc/qt6/qtnetwork/qtnetwork-fortuneclient-example.html
/usr/share/doc/qt6/qtnetwork/qtnetwork-fortuneserver-example.html
/usr/share/doc/qt6/qtnetwork/qtnetwork-http-example.html
/usr/share/doc/qt6/qtnetwork/qtnetwork-index.html
/usr/share/doc/qt6/qtnetwork/qtnetwork-module.html
/usr/share/doc/qt6/qtnetwork/qtnetwork-multicastreceiver-example.html
/usr/share/doc/qt6/qtnetwork/qtnetwork-multicastsender-example.html
/usr/share/doc/qt6/qtnetwork/qtnetwork-network-chat-example.html
/usr/share/doc/qt6/qtnetwork/qtnetwork-programming.html
/usr/share/doc/qt6/qtnetwork/qtnetwork-rsslisting-example.html
/usr/share/doc/qt6/qtnetwork/qtnetwork-securesocketclient-example.html
/usr/share/doc/qt6/qtnetwork/qtnetwork-secureudpclient-example.html
/usr/share/doc/qt6/qtnetwork/qtnetwork-secureudpserver-example.html
/usr/share/doc/qt6/qtnetwork/qtnetwork-threadedfortuneserver-example.html
/usr/share/doc/qt6/qtnetwork/qtnetwork-torrent-example.html
/usr/share/doc/qt6/qtnetwork/qtnetwork.index
/usr/share/doc/qt6/qtnetwork/qtnetwork.qhp
/usr/share/doc/qt6/qtnetwork/qtnetwork.qhp.sha1
/usr/share/doc/qt6/qtnetwork/qudpsocket-members.html
/usr/share/doc/qt6/qtnetwork/qudpsocket.html
/usr/share/doc/qt6/qtnetwork/ssl.html
/usr/share/doc/qt6/qtnetwork/style
/usr/share/doc/qt6/qtnetwork/style/offline-dark.css
/usr/share/doc/qt6/qtnetwork/style/offline-simple.css
/usr/share/doc/qt6/qtnetwork/style/offline.css
/usr/share/doc/qt6/qtnetworkauth/examples-manifest.xml
/usr/share/doc/qt6/qtnetworkauth/examples-qtnetworkauth.html
/usr/share/doc/qt6/qtnetworkauth/images
/usr/share/doc/qt6/qtnetworkauth/images/arrow_bc.png
/usr/share/doc/qt6/qtnetworkauth/images/bgrContent.png
/usr/share/doc/qt6/qtnetworkauth/images/btn_next.png
/usr/share/doc/qt6/qtnetworkauth/images/btn_prev.png
/usr/share/doc/qt6/qtnetworkauth/images/bullet_dn.png
/usr/share/doc/qt6/qtnetworkauth/images/bullet_sq.png
/usr/share/doc/qt6/qtnetworkauth/images/home.png
/usr/share/doc/qt6/qtnetworkauth/images/ico_note.png
/usr/share/doc/qt6/qtnetworkauth/images/ico_note_attention.png
/usr/share/doc/qt6/qtnetworkauth/images/ico_out.png
/usr/share/doc/qt6/qtnetworkauth/images/logo.png
/usr/share/doc/qt6/qtnetworkauth/images/redditclient-example.png
/usr/share/doc/qt6/qtnetworkauth/qabstractoauth-members.html
/usr/share/doc/qt6/qtnetworkauth/qabstractoauth.html
/usr/share/doc/qt6/qtnetworkauth/qabstractoauth2-members.html
/usr/share/doc/qt6/qtnetworkauth/qabstractoauth2.html
/usr/share/doc/qt6/qtnetworkauth/qabstractoauthreplyhandler-members.html
/usr/share/doc/qt6/qtnetworkauth/qabstractoauthreplyhandler.html
/usr/share/doc/qt6/qtnetworkauth/qoauth1-members.html
/usr/share/doc/qt6/qtnetworkauth/qoauth1.html
/usr/share/doc/qt6/qtnetworkauth/qoauth1signature-members.html
/usr/share/doc/qt6/qtnetworkauth/qoauth1signature.html
/usr/share/doc/qt6/qtnetworkauth/qoauth2authorizationcodeflow-members.html
/usr/share/doc/qt6/qtnetworkauth/qoauth2authorizationcodeflow.html
/usr/share/doc/qt6/qtnetworkauth/qtnetworkauth-index.html
/usr/share/doc/qt6/qtnetworkauth/qtnetworkauth-module.html
/usr/share/doc/qt6/qtnetworkauth/qtnetworkauth-redditclient-example.html
/usr/share/doc/qt6/qtnetworkauth/qtnetworkauth.index
/usr/share/doc/qt6/qtnetworkauth/qtnetworkauth.qhp
/usr/share/doc/qt6/qtnetworkauth/qtnetworkauth.qhp.sha1
/usr/share/doc/qt6/qtnetworkauth/style
/usr/share/doc/qt6/qtnetworkauth/style/offline-dark.css
/usr/share/doc/qt6/qtnetworkauth/style/offline-simple.css
/usr/share/doc/qt6/qtnetworkauth/style/offline.css
/usr/share/doc/qt6/qtnfc/examples-manifest.xml
/usr/share/doc/qt6/qtnfc/images
/usr/share/doc/qt6/qtnfc/images/annotatedurl.png
/usr/share/doc/qt6/qtnfc/images/annotatedurl2.png
/usr/share/doc/qt6/qtnfc/images/annotatedurl3.png
/usr/share/doc/qt6/qtnfc/images/arrow_bc.png
/usr/share/doc/qt6/qtnfc/images/bgrContent.png
/usr/share/doc/qt6/qtnfc/images/btn_next.png
/usr/share/doc/qt6/qtnfc/images/btn_prev.png
/usr/share/doc/qt6/qtnfc/images/bullet_dn.png
/usr/share/doc/qt6/qtnfc/images/bullet_sq.png
/usr/share/doc/qt6/qtnfc/images/home.png
/usr/share/doc/qt6/qtnfc/images/ico_note.png
/usr/share/doc/qt6/qtnfc/images/ico_note_attention.png
/usr/share/doc/qt6/qtnfc/images/ico_out.png
/usr/share/doc/qt6/qtnfc/images/logo.png
/usr/share/doc/qt6/qtnfc/images/ndefeditor.png
/usr/share/doc/qt6/qtnfc/nfc-android.html
/usr/share/doc/qt6/qtnfc/nfc-examples.html
/usr/share/doc/qt6/qtnfc/qndeffilter-members.html
/usr/share/doc/qt6/qtnfc/qndeffilter-record.html
/usr/share/doc/qt6/qtnfc/qndeffilter.html
/usr/share/doc/qt6/qtnfc/qndefmessage-members.html
/usr/share/doc/qt6/qtnfc/qndefmessage.html
/usr/share/doc/qt6/qtnfc/qndefnfciconrecord-members.html
/usr/share/doc/qt6/qtnfc/qndefnfciconrecord.html
/usr/share/doc/qt6/qtnfc/qndefnfcsmartposterrecord-members.html
/usr/share/doc/qt6/qtnfc/qndefnfcsmartposterrecord.html
/usr/share/doc/qt6/qtnfc/qndefnfctextrecord-members.html
/usr/share/doc/qt6/qtnfc/qndefnfctextrecord.html
/usr/share/doc/qt6/qtnfc/qndefnfcurirecord-members.html
/usr/share/doc/qt6/qtnfc/qndefnfcurirecord.html
/usr/share/doc/qt6/qtnfc/qndefrecord-members.html
/usr/share/doc/qt6/qtnfc/qndefrecord.html
/usr/share/doc/qt6/qtnfc/qnearfieldmanager-members.html
/usr/share/doc/qt6/qtnfc/qnearfieldmanager.html
/usr/share/doc/qt6/qtnfc/qnearfieldtarget-members.html
/usr/share/doc/qt6/qtnfc/qnearfieldtarget-requestid-members.html
/usr/share/doc/qt6/qtnfc/qnearfieldtarget-requestid.html
/usr/share/doc/qt6/qtnfc/qnearfieldtarget.html
/usr/share/doc/qt6/qtnfc/qtnfc-annotatedurl-example.html
/usr/share/doc/qt6/qtnfc/qtnfc-attribution-ndefeditor.html
/usr/share/doc/qt6/qtnfc/qtnfc-changes-qt6.html
/usr/share/doc/qt6/qtnfc/qtnfc-features.html
/usr/share/doc/qt6/qtnfc/qtnfc-index.html
/usr/share/doc/qt6/qtnfc/qtnfc-module.html
/usr/share/doc/qt6/qtnfc/qtnfc-ndefeditor-example.html
/usr/share/doc/qt6/qtnfc/qtnfc-overview.html
/usr/share/doc/qt6/qtnfc/qtnfc-pcsc.html
/usr/share/doc/qt6/qtnfc/qtnfc.index
/usr/share/doc/qt6/qtnfc/qtnfc.qhp
/usr/share/doc/qt6/qtnfc/qtnfc.qhp.sha1
/usr/share/doc/qt6/qtnfc/style
/usr/share/doc/qt6/qtnfc/style/offline-dark.css
/usr/share/doc/qt6/qtnfc/style/offline-simple.css
/usr/share/doc/qt6/qtnfc/style/offline.css
/usr/share/doc/qt6/qtopcua/examples-manifest.xml
/usr/share/doc/qt6/qtopcua/images
/usr/share/doc/qt6/qtopcua/images/arrow_bc.png
/usr/share/doc/qt6/qtopcua/images/bgrContent.png
/usr/share/doc/qt6/qtopcua/images/btn_next.png
/usr/share/doc/qt6/qtopcua/images/btn_prev.png
/usr/share/doc/qt6/qtopcua/images/bullet_dn.png
/usr/share/doc/qt6/qtopcua/images/bullet_sq.png
/usr/share/doc/qt6/qtopcua/images/home.png
/usr/share/doc/qt6/qtopcua/images/ico_note.png
/usr/share/doc/qt6/qtopcua/images/ico_note_attention.png
/usr/share/doc/qt6/qtopcua/images/ico_out.png
/usr/share/doc/qt6/qtopcua/images/logo.png
/usr/share/doc/qt6/qtopcua/images/opcuaviewer.png
/usr/share/doc/qt6/qtopcua/images/tankexample.jpg
/usr/share/doc/qt6/qtopcua/images/tankexample.png
/usr/share/doc/qt6/qtopcua/qml-qtopcua-applicationdescription-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-applicationdescription.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-attributeoperand-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-attributeoperand.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-authenticationinformation-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-authenticationinformation.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-connection-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-connection.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-elementoperand-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-elementoperand.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-endpointdescription-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-endpointdescription.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-endpointdiscovery-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-endpointdiscovery.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-eventfilter-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-eventfilter.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-filterelement-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-filterelement.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-literaloperand-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-literaloperand.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-localizedtext-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-localizedtext.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-methodargument-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-methodargument.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-methodnode-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-methodnode.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-node-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-node.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-nodeid-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-nodeid.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-readitem-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-readitem.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-readresult-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-readresult.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-relativenodeid-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-relativenodeid.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-relativenodepath-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-relativenodepath.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-serverdiscovery-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-serverdiscovery.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-simpleattributeoperand-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-simpleattributeoperand.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-status-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-status.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-usertokenpolicy-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-usertokenpolicy.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-valuenode-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-valuenode.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-writeitem-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-writeitem.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-writeresult-members.html
/usr/share/doc/qt6/qtopcua/qml-qtopcua-writeresult.html
/usr/share/doc/qt6/qtopcua/qopcua-nodeids.html
/usr/share/doc/qt6/qtopcua/qopcua.html
/usr/share/doc/qt6/qtopcua/qopcuaaddnodeitem-members.html
/usr/share/doc/qt6/qtopcua/qopcuaaddnodeitem.html
/usr/share/doc/qt6/qtopcua/qopcuaaddreferenceitem-members.html
/usr/share/doc/qt6/qtopcua/qopcuaaddreferenceitem.html
/usr/share/doc/qt6/qtopcua/qopcuaapplicationdescription-members.html
/usr/share/doc/qt6/qtopcua/qopcuaapplicationdescription.html
/usr/share/doc/qt6/qtopcua/qopcuaapplicationidentity-members.html
/usr/share/doc/qt6/qtopcua/qopcuaapplicationidentity.html
/usr/share/doc/qt6/qtopcua/qopcuaapplicationrecorddatatype-members.html
/usr/share/doc/qt6/qtopcua/qopcuaapplicationrecorddatatype.html
/usr/share/doc/qt6/qtopcua/qopcuaargument-members.html
/usr/share/doc/qt6/qtopcua/qopcuaargument.html
/usr/share/doc/qt6/qtopcua/qopcuaattributeoperand-members.html
/usr/share/doc/qt6/qtopcua/qopcuaattributeoperand.html
/usr/share/doc/qt6/qtopcua/qopcuaauthenticationinformation-members.html
/usr/share/doc/qt6/qtopcua/qopcuaauthenticationinformation.html
/usr/share/doc/qt6/qtopcua/qopcuaaxisinformation-members.html
/usr/share/doc/qt6/qtopcua/qopcuaaxisinformation.html
/usr/share/doc/qt6/qtopcua/qopcuabinarydataencoding-members.html
/usr/share/doc/qt6/qtopcua/qopcuabinarydataencoding.html
/usr/share/doc/qt6/qtopcua/qopcuabrowsepathtarget-members.html
/usr/share/doc/qt6/qtopcua/qopcuabrowsepathtarget.html
/usr/share/doc/qt6/qtopcua/qopcuabrowserequest-members.html
/usr/share/doc/qt6/qtopcua/qopcuabrowserequest.html
/usr/share/doc/qt6/qtopcua/qopcuaclient-members.html
/usr/share/doc/qt6/qtopcua/qopcuaclient.html
/usr/share/doc/qt6/qtopcua/qopcuacomplexnumber-members.html
/usr/share/doc/qt6/qtopcua/qopcuacomplexnumber.html
/usr/share/doc/qt6/qtopcua/qopcuaconnectionsettings-members.html
/usr/share/doc/qt6/qtopcua/qopcuaconnectionsettings.html
/usr/share/doc/qt6/qtopcua/qopcuacontentfilterelement-members.html
/usr/share/doc/qt6/qtopcua/qopcuacontentfilterelement.html
/usr/share/doc/qt6/qtopcua/qopcuacontentfilterelementresult-members.html
/usr/share/doc/qt6/qtopcua/qopcuacontentfilterelementresult.html
/usr/share/doc/qt6/qtopcua/qopcuadatavalue-members.html
/usr/share/doc/qt6/qtopcua/qopcuadatavalue.html
/usr/share/doc/qt6/qtopcua/qopcuadeletereferenceitem-members.html
/usr/share/doc/qt6/qtopcua/qopcuadeletereferenceitem.html
/usr/share/doc/qt6/qtopcua/qopcuadoublecomplexnumber-members.html
/usr/share/doc/qt6/qtopcua/qopcuadoublecomplexnumber.html
/usr/share/doc/qt6/qtopcua/qopcuaelementoperand-members.html
/usr/share/doc/qt6/qtopcua/qopcuaelementoperand.html
/usr/share/doc/qt6/qtopcua/qopcuaendpointdescription-members.html
/usr/share/doc/qt6/qtopcua/qopcuaendpointdescription.html
/usr/share/doc/qt6/qtopcua/qopcuaerrorstate-members.html
/usr/share/doc/qt6/qtopcua/qopcuaerrorstate.html
/usr/share/doc/qt6/qtopcua/qopcuaeuinformation-members.html
/usr/share/doc/qt6/qtopcua/qopcuaeuinformation.html
/usr/share/doc/qt6/qtopcua/qopcuaeventfilterresult-members.html
/usr/share/doc/qt6/qtopcua/qopcuaeventfilterresult.html
/usr/share/doc/qt6/qtopcua/qopcuaexpandednodeid-members.html
/usr/share/doc/qt6/qtopcua/qopcuaexpandednodeid.html
/usr/share/doc/qt6/qtopcua/qopcuaextensionobject-members.html
/usr/share/doc/qt6/qtopcua/qopcuaextensionobject.html
/usr/share/doc/qt6/qtopcua/qopcuagdsclient-members.html
/usr/share/doc/qt6/qtopcua/qopcuagdsclient.html
/usr/share/doc/qt6/qtopcua/qopcuahistorydata-members.html
/usr/share/doc/qt6/qtopcua/qopcuahistorydata.html
/usr/share/doc/qt6/qtopcua/qopcuahistoryreadrawrequest-members.html
/usr/share/doc/qt6/qtopcua/qopcuahistoryreadrawrequest.html
/usr/share/doc/qt6/qtopcua/qopcuahistoryreadresponse-members.html
/usr/share/doc/qt6/qtopcua/qopcuahistoryreadresponse.html
/usr/share/doc/qt6/qtopcua/qopcuakeypair-members.html
/usr/share/doc/qt6/qtopcua/qopcuakeypair.html
/usr/share/doc/qt6/qtopcua/qopcualiteraloperand-members.html
/usr/share/doc/qt6/qtopcua/qopcualiteraloperand.html
/usr/share/doc/qt6/qtopcua/qopcualocalizedtext-members.html
/usr/share/doc/qt6/qtopcua/qopcualocalizedtext.html
/usr/share/doc/qt6/qtopcua/qopcuamonitoringparameters-datachangefilter-members.html
/usr/share/doc/qt6/qtopcua/qopcuamonitoringparameters-datachangefilter.html
/usr/share/doc/qt6/qtopcua/qopcuamonitoringparameters-eventfilter-members.html
/usr/share/doc/qt6/qtopcua/qopcuamonitoringparameters-eventfilter.html
/usr/share/doc/qt6/qtopcua/qopcuamonitoringparameters-members.html
/usr/share/doc/qt6/qtopcua/qopcuamonitoringparameters.html
/usr/share/doc/qt6/qtopcua/qopcuamultidimensionalarray-members.html
/usr/share/doc/qt6/qtopcua/qopcuamultidimensionalarray.html
/usr/share/doc/qt6/qtopcua/qopcuanode-members.html
/usr/share/doc/qt6/qtopcua/qopcuanode.html
/usr/share/doc/qt6/qtopcua/qopcuanodecreationattributes-members.html
/usr/share/doc/qt6/qtopcua/qopcuanodecreationattributes.html
/usr/share/doc/qt6/qtopcua/qopcuapkiconfiguration-members.html
/usr/share/doc/qt6/qtopcua/qopcuapkiconfiguration.html
/usr/share/doc/qt6/qtopcua/qopcuaprovider-members.html
/usr/share/doc/qt6/qtopcua/qopcuaprovider.html
/usr/share/doc/qt6/qtopcua/qopcuaqualifiedname-members.html
/usr/share/doc/qt6/qtopcua/qopcuaqualifiedname.html
/usr/share/doc/qt6/qtopcua/qopcuarange-members.html
/usr/share/doc/qt6/qtopcua/qopcuarange.html
/usr/share/doc/qt6/qtopcua/qopcuareaditem-members.html
/usr/share/doc/qt6/qtopcua/qopcuareaditem.html
/usr/share/doc/qt6/qtopcua/qopcuareadresult-members.html
/usr/share/doc/qt6/qtopcua/qopcuareadresult.html
/usr/share/doc/qt6/qtopcua/qopcuareferencedescription-members.html
/usr/share/doc/qt6/qtopcua/qopcuareferencedescription.html
/usr/share/doc/qt6/qtopcua/qopcuarelativepathelement-members.html
/usr/share/doc/qt6/qtopcua/qopcuarelativepathelement.html
/usr/share/doc/qt6/qtopcua/qopcuasimpleattributeoperand-members.html
/usr/share/doc/qt6/qtopcua/qopcuasimpleattributeoperand.html
/usr/share/doc/qt6/qtopcua/qopcuausertokenpolicy-members.html
/usr/share/doc/qt6/qtopcua/qopcuausertokenpolicy.html
/usr/share/doc/qt6/qtopcua/qopcuawriteitem-members.html
/usr/share/doc/qt6/qtopcua/qopcuawriteitem.html
/usr/share/doc/qt6/qtopcua/qopcuawriteresult-members.html
/usr/share/doc/qt6/qtopcua/qopcuawriteresult.html
/usr/share/doc/qt6/qtopcua/qopcuax509certificatesigningrequest-members.html
/usr/share/doc/qt6/qtopcua/qopcuax509certificatesigningrequest.html
/usr/share/doc/qt6/qtopcua/qopcuax509distinguishedname-members.html
/usr/share/doc/qt6/qtopcua/qopcuax509distinguishedname.html
/usr/share/doc/qt6/qtopcua/qopcuax509extension-members.html
/usr/share/doc/qt6/qtopcua/qopcuax509extension.html
/usr/share/doc/qt6/qtopcua/qopcuax509extensionbasicconstraints-members.html
/usr/share/doc/qt6/qtopcua/qopcuax509extensionbasicconstraints.html
/usr/share/doc/qt6/qtopcua/qopcuax509extensionextendedkeyusage-members.html
/usr/share/doc/qt6/qtopcua/qopcuax509extensionextendedkeyusage.html
/usr/share/doc/qt6/qtopcua/qopcuax509extensionkeyusage-members.html
/usr/share/doc/qt6/qtopcua/qopcuax509extensionkeyusage.html
/usr/share/doc/qt6/qtopcua/qopcuax509extensionsubjectalternativename-members.html
/usr/share/doc/qt6/qtopcua/qopcuax509extensionsubjectalternativename.html
/usr/share/doc/qt6/qtopcua/qopcuaxvalue-members.html
/usr/share/doc/qt6/qtopcua/qopcuaxvalue.html
/usr/share/doc/qt6/qtopcua/qtopcua-attribution-open62541.html
/usr/share/doc/qt6/qtopcua/qtopcua-build-open62541.html
/usr/share/doc/qt6/qtopcua/qtopcua-build-openssl.html
/usr/share/doc/qt6/qtopcua/qtopcua-build-uacpp.html
/usr/share/doc/qt6/qtopcua/qtopcua-examples.html
/usr/share/doc/qt6/qtopcua/qtopcua-index.html
/usr/share/doc/qt6/qtopcua/qtopcua-module.html
/usr/share/doc/qt6/qtopcua/qtopcua-opcuaviewer-certificatedialog-cpp.html
/usr/share/doc/qt6/qtopcua/qtopcua-opcuaviewer-cmakelists-txt.html
/usr/share/doc/qt6/qtopcua/qtopcua-opcuaviewer-example.html
/usr/share/doc/qt6/qtopcua/qtopcua-opcuaviewer-main-cpp.html
/usr/share/doc/qt6/qtopcua/qtopcua-opcuaviewer-mainwindow-cpp.html
/usr/share/doc/qt6/qtopcua/qtopcua-opcuaviewer-opcuamodel-cpp.html
/usr/share/doc/qt6/qtopcua/qtopcua-opcuaviewer-opcuaviewer-pro.html
/usr/share/doc/qt6/qtopcua/qtopcua-opcuaviewer-treeitem-cpp.html
/usr/share/doc/qt6/qtopcua/qtopcua-overview.html
/usr/share/doc/qt6/qtopcua/qtopcua-qmlmodule.html
/usr/share/doc/qt6/qtopcua/qtopcua-security.html
/usr/share/doc/qt6/qtopcua/qtopcua-waterpump-waterpump-qml-cmakelists-txt.html
/usr/share/doc/qt6/qtopcua/qtopcua-waterpump-waterpump-qml-example.html
/usr/share/doc/qt6/qtopcua/qtopcua-waterpump-waterpump-qml-main-cpp.html
/usr/share/doc/qt6/qtopcua/qtopcua-waterpump-waterpump-qml-qml-qrc.html
/usr/share/doc/qt6/qtopcua/qtopcua-waterpump-waterpump-qml-waterpump-qml-pro.html
/usr/share/doc/qt6/qtopcua/qtopcua-waterpump-waterpump-qmlcpp-cmakelists-txt.html
/usr/share/doc/qt6/qtopcua/qtopcua-waterpump-waterpump-qmlcpp-example.html
/usr/share/doc/qt6/qtopcua/qtopcua-waterpump-waterpump-qmlcpp-main-cpp.html
/usr/share/doc/qt6/qtopcua/qtopcua-waterpump-waterpump-qmlcpp-opcuamachinebackend-cpp.html
/usr/share/doc/qt6/qtopcua/qtopcua-waterpump-waterpump-qmlcpp-qml-qrc.html
/usr/share/doc/qt6/qtopcua/qtopcua-waterpump-waterpump-qmlcpp-waterpump-qmlcpp-pro.html
/usr/share/doc/qt6/qtopcua/qtopcua-x509-cmakelists-txt.html
/usr/share/doc/qt6/qtopcua/qtopcua-x509-example.html
/usr/share/doc/qt6/qtopcua/qtopcua-x509-main-cpp.html
/usr/share/doc/qt6/qtopcua/qtopcua-x509-x509-pro.html
/usr/share/doc/qt6/qtopcua/qtopcua.index
/usr/share/doc/qt6/qtopcua/qtopcua.qhp
/usr/share/doc/qt6/qtopcua/qtopcua.qhp.sha1
/usr/share/doc/qt6/qtopcua/style
/usr/share/doc/qt6/qtopcua/style/offline-dark.css
/usr/share/doc/qt6/qtopcua/style/offline-simple.css
/usr/share/doc/qt6/qtopcua/style/offline.css
/usr/share/doc/qt6/qtopcua/uacpp-index.html
/usr/share/doc/qt6/qtopengl/examples-manifest.xml
/usr/share/doc/qt6/qtopengl/examples-widgets-opengl.html
/usr/share/doc/qt6/qtopengl/images
/usr/share/doc/qt6/qtopengl/images/2dpainting-example.png
/usr/share/doc/qt6/qtopengl/images/arrow_bc.png
/usr/share/doc/qt6/qtopengl/images/bgrContent.png
/usr/share/doc/qt6/qtopengl/images/btn_next.png
/usr/share/doc/qt6/qtopengl/images/btn_prev.png
/usr/share/doc/qt6/qtopengl/images/bullet_dn.png
/usr/share/doc/qt6/qtopengl/images/bullet_sq.png
/usr/share/doc/qt6/qtopengl/images/cube.png
/usr/share/doc/qt6/qtopengl/images/cube_faces.png
/usr/share/doc/qt6/qtopengl/images/hellogl2-example.png
/usr/share/doc/qt6/qtopengl/images/hellogles3-example.png
/usr/share/doc/qt6/qtopengl/images/home.png
/usr/share/doc/qt6/qtopengl/images/ico_note.png
/usr/share/doc/qt6/qtopengl/images/ico_note_attention.png
/usr/share/doc/qt6/qtopengl/images/ico_out.png
/usr/share/doc/qt6/qtopengl/images/logo.png
/usr/share/doc/qt6/qtopengl/images/opengl-examples.png
/usr/share/doc/qt6/qtopengl/images/openglwindow-example.png
/usr/share/doc/qt6/qtopengl/images/stereoexample-leftbuffer.png
/usr/share/doc/qt6/qtopengl/images/stereoexample-rightbuffer.png
/usr/share/doc/qt6/qtopengl/images/textures-example.png
/usr/share/doc/qt6/qtopengl/opengl-changes-qt6.html
/usr/share/doc/qt6/qtopengl/qabstractopenglfunctions-members.html
/usr/share/doc/qt6/qtopengl/qabstractopenglfunctions.html
/usr/share/doc/qt6/qtopengl/qopenglbuffer-members.html
/usr/share/doc/qt6/qtopengl/qopenglbuffer.html
/usr/share/doc/qt6/qtopengl/qopengldebuglogger-members.html
/usr/share/doc/qt6/qtopengl/qopengldebuglogger.html
/usr/share/doc/qt6/qtopengl/qopengldebugmessage-members.html
/usr/share/doc/qt6/qtopengl/qopengldebugmessage.html
/usr/share/doc/qt6/qtopengl/qopenglframebufferobject-members.html
/usr/share/doc/qt6/qtopengl/qopenglframebufferobject.html
/usr/share/doc/qt6/qtopengl/qopenglframebufferobjectformat-members.html
/usr/share/doc/qt6/qtopengl/qopenglframebufferobjectformat.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-1-0.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-1-1.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-1-2.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-1-3.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-1-4.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-1-5.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-2-0.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-2-1.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-3-0.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-3-1.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-3-2-compatibility.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-3-2-core.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-3-3-compatibility.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-3-3-core.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-4-0-compatibility.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-4-0-core.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-4-1-compatibility.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-4-1-core.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-4-2-compatibility.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-4-2-core.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-4-3-compatibility.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-4-3-core.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-4-4-compatibility.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-4-4-core.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-4-5-compatibility.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-4-5-core.html
/usr/share/doc/qt6/qtopengl/qopenglfunctions-es2.html
/usr/share/doc/qt6/qtopengl/qopenglpaintdevice-members.html
/usr/share/doc/qt6/qtopengl/qopenglpaintdevice.html
/usr/share/doc/qt6/qtopengl/qopenglpixeltransferoptions-members.html
/usr/share/doc/qt6/qtopengl/qopenglpixeltransferoptions.html
/usr/share/doc/qt6/qtopengl/qopenglshader-members.html
/usr/share/doc/qt6/qtopengl/qopenglshader.html
/usr/share/doc/qt6/qtopengl/qopenglshaderprogram-members.html
/usr/share/doc/qt6/qtopengl/qopenglshaderprogram.html
/usr/share/doc/qt6/qtopengl/qopengltexture-members.html
/usr/share/doc/qt6/qtopengl/qopengltexture.html
/usr/share/doc/qt6/qtopengl/qopengltextureblitter-members.html
/usr/share/doc/qt6/qtopengl/qopengltextureblitter.html
/usr/share/doc/qt6/qtopengl/qopengltimemonitor-members.html
/usr/share/doc/qt6/qtopengl/qopengltimemonitor.html
/usr/share/doc/qt6/qtopengl/qopengltimerquery-members.html
/usr/share/doc/qt6/qtopengl/qopengltimerquery.html
/usr/share/doc/qt6/qtopengl/qopenglversionfunctionsfactory-members.html
/usr/share/doc/qt6/qtopengl/qopenglversionfunctionsfactory.html
/usr/share/doc/qt6/qtopengl/qopenglversionprofile-members.html
/usr/share/doc/qt6/qtopengl/qopenglversionprofile.html
/usr/share/doc/qt6/qtopengl/qopenglvertexarrayobject-binder-members.html
/usr/share/doc/qt6/qtopengl/qopenglvertexarrayobject-binder.html
/usr/share/doc/qt6/qtopengl/qopenglvertexarrayobject-members.html
/usr/share/doc/qt6/qtopengl/qopenglvertexarrayobject.html
/usr/share/doc/qt6/qtopengl/qopenglwidget-members.html
/usr/share/doc/qt6/qtopengl/qopenglwidget.html
/usr/share/doc/qt6/qtopengl/qopenglwindow-members.html
/usr/share/doc/qt6/qtopengl/qopenglwindow.html
/usr/share/doc/qt6/qtopengl/qtopengl-2dpainting-example.html
/usr/share/doc/qt6/qtopengl/qtopengl-cube-example.html
/usr/share/doc/qt6/qtopengl/qtopengl-hellogl2-example.html
/usr/share/doc/qt6/qtopengl/qtopengl-hellogles3-example.html
/usr/share/doc/qt6/qtopengl/qtopengl-index.html
/usr/share/doc/qt6/qtopengl/qtopengl-module.html
/usr/share/doc/qt6/qtopengl/qtopengl-openglwindow-example.html
/usr/share/doc/qt6/qtopengl/qtopengl-stereoqopenglwidget-example.html
/usr/share/doc/qt6/qtopengl/qtopengl-textures-example.html
/usr/share/doc/qt6/qtopengl/qtopengl.index
/usr/share/doc/qt6/qtopengl/qtopengl.qhp
/usr/share/doc/qt6/qtopengl/qtopengl.qhp.sha1
/usr/share/doc/qt6/qtopengl/qtopenglwidgets-module.html
/usr/share/doc/qt6/qtopengl/style
/usr/share/doc/qt6/qtopengl/style/offline-dark.css
/usr/share/doc/qt6/qtopengl/style/offline-simple.css
/usr/share/doc/qt6/qtopengl/style/offline.css
/usr/share/doc/qt6/qtpdf/examples-manifest.xml
/usr/share/doc/qt6/qtpdf/images
/usr/share/doc/qt6/qtpdf/images/arrow_bc.png
/usr/share/doc/qt6/qtpdf/images/bgrContent.png
/usr/share/doc/qt6/qtpdf/images/btn_next.png
/usr/share/doc/qt6/qtpdf/images/btn_prev.png
/usr/share/doc/qt6/qtpdf/images/bullet_dn.png
/usr/share/doc/qt6/qtpdf/images/bullet_sq.png
/usr/share/doc/qt6/qtpdf/images/home.png
/usr/share/doc/qt6/qtpdf/images/ico_note.png
/usr/share/doc/qt6/qtpdf/images/ico_note_attention.png
/usr/share/doc/qt6/qtpdf/images/ico_out.png
/usr/share/doc/qt6/qtpdf/images/logo.png
/usr/share/doc/qt6/qtpdf/images/multipageviewer.png
/usr/share/doc/qt6/qtpdf/images/pdfviewer.png
/usr/share/doc/qt6/qtpdf/images/search-results.png
/usr/share/doc/qt6/qtpdf/images/wrapping-search-result.png
/usr/share/doc/qt6/qtpdf/qml-qtquick-pdf-pdfbookmarkmodel-members.html
/usr/share/doc/qt6/qtpdf/qml-qtquick-pdf-pdfbookmarkmodel.html
/usr/share/doc/qt6/qtpdf/qml-qtquick-pdf-pdfdocument-members.html
/usr/share/doc/qt6/qtpdf/qml-qtquick-pdf-pdfdocument.html
/usr/share/doc/qt6/qtpdf/qml-qtquick-pdf-pdflinkdelegate-members.html
/usr/share/doc/qt6/qtpdf/qml-qtquick-pdf-pdflinkdelegate.html
/usr/share/doc/qt6/qtpdf/qml-qtquick-pdf-pdflinkmodel-members.html
/usr/share/doc/qt6/qtpdf/qml-qtquick-pdf-pdflinkmodel.html
/usr/share/doc/qt6/qtpdf/qml-qtquick-pdf-pdfmultipageview-members.html
/usr/share/doc/qt6/qtpdf/qml-qtquick-pdf-pdfmultipageview.html
/usr/share/doc/qt6/qtpdf/qml-qtquick-pdf-pdfpageimage-members.html
/usr/share/doc/qt6/qtpdf/qml-qtquick-pdf-pdfpageimage.html
/usr/share/doc/qt6/qtpdf/qml-qtquick-pdf-pdfpagenavigator-members.html
/usr/share/doc/qt6/qtpdf/qml-qtquick-pdf-pdfpagenavigator.html
/usr/share/doc/qt6/qtpdf/qml-qtquick-pdf-pdfpageview-members.html
/usr/share/doc/qt6/qtpdf/qml-qtquick-pdf-pdfpageview.html
/usr/share/doc/qt6/qtpdf/qml-qtquick-pdf-pdfscrollablepageview-members.html
/usr/share/doc/qt6/qtpdf/qml-qtquick-pdf-pdfscrollablepageview.html
/usr/share/doc/qt6/qtpdf/qml-qtquick-pdf-pdfsearchmodel-members.html
/usr/share/doc/qt6/qtpdf/qml-qtquick-pdf-pdfsearchmodel.html
/usr/share/doc/qt6/qtpdf/qml-qtquick-pdf-pdfselection-members.html
/usr/share/doc/qt6/qtpdf/qml-qtquick-pdf-pdfselection.html
/usr/share/doc/qt6/qtpdf/qml-qtquick-pdf-pdfstyle-members.html
/usr/share/doc/qt6/qtpdf/qml-qtquick-pdf-pdfstyle.html
/usr/share/doc/qt6/qtpdf/qpdfbookmarkmodel-members.html
/usr/share/doc/qt6/qtpdf/qpdfbookmarkmodel.html
/usr/share/doc/qt6/qtpdf/qpdfdocument-members.html
/usr/share/doc/qt6/qtpdf/qpdfdocument.html
/usr/share/doc/qt6/qtpdf/qpdfdocumentrenderoptions-members.html
/usr/share/doc/qt6/qtpdf/qpdfdocumentrenderoptions.html
/usr/share/doc/qt6/qtpdf/qpdflink-members.html
/usr/share/doc/qt6/qtpdf/qpdflink.html
/usr/share/doc/qt6/qtpdf/qpdflinkmodel-members.html
/usr/share/doc/qt6/qtpdf/qpdflinkmodel.html
/usr/share/doc/qt6/qtpdf/qpdfpagenavigator-members.html
/usr/share/doc/qt6/qtpdf/qpdfpagenavigator.html
/usr/share/doc/qt6/qtpdf/qpdfpagerenderer-members.html
/usr/share/doc/qt6/qtpdf/qpdfpagerenderer.html
/usr/share/doc/qt6/qtpdf/qpdfpageselector-members.html
/usr/share/doc/qt6/qtpdf/qpdfpageselector.html
/usr/share/doc/qt6/qtpdf/qpdfsearchmodel-members.html
/usr/share/doc/qt6/qtpdf/qpdfsearchmodel.html
/usr/share/doc/qt6/qtpdf/qpdfselection-members.html
/usr/share/doc/qt6/qtpdf/qpdfselection.html
/usr/share/doc/qt6/qtpdf/qpdfview-members.html
/usr/share/doc/qt6/qtpdf/qpdfview.html
/usr/share/doc/qt6/qtpdf/qtpdf-3rdparty-abseil.html
/usr/share/doc/qt6/qtpdf/qtpdf-3rdparty-freetype.html
/usr/share/doc/qt6/qtpdf/qtpdf-3rdparty-harfbuzz-ng.html
/usr/share/doc/qt6/qtpdf/qtpdf-3rdparty-icu.html
/usr/share/doc/qt6/qtpdf/qtpdf-3rdparty-libjpeg-turbo.html
/usr/share/doc/qt6/qtpdf/qtpdf-3rdparty-libpng.html
/usr/share/doc/qt6/qtpdf/qtpdf-3rdparty-pdfium.html
/usr/share/doc/qt6/qtpdf/qtpdf-3rdparty-the-chromium-project.html
/usr/share/doc/qt6/qtpdf/qtpdf-3rdparty-zlib.html
/usr/share/doc/qt6/qtpdf/qtpdf-examples.html
/usr/share/doc/qt6/qtpdf/qtpdf-index.html
/usr/share/doc/qt6/qtpdf/qtpdf-licensing.html
/usr/share/doc/qt6/qtpdf/qtpdf-module.html
/usr/share/doc/qt6/qtpdf/qtpdf-multipage-example.html
/usr/share/doc/qt6/qtpdf/qtpdf-pdfviewer-example.html
/usr/share/doc/qt6/qtpdf/qtpdf-platformnotes.html
/usr/share/doc/qt6/qtpdf/qtpdf.index
/usr/share/doc/qt6/qtpdf/qtpdf.qhp
/usr/share/doc/qt6/qtpdf/qtpdf.qhp.sha1
/usr/share/doc/qt6/qtpdf/qtquick-pdf-qmlmodule.html
/usr/share/doc/qt6/qtpdf/style
/usr/share/doc/qt6/qtpdf/style/offline-dark.css
/usr/share/doc/qt6/qtpdf/style/offline-simple.css
/usr/share/doc/qt6/qtpdf/style/offline.css
/usr/share/doc/qt6/qtplatformintegration/images
/usr/share/doc/qt6/qtplatformintegration/images/arrow_bc.png
/usr/share/doc/qt6/qtplatformintegration/images/bgrContent.png
/usr/share/doc/qt6/qtplatformintegration/images/btn_next.png
/usr/share/doc/qt6/qtplatformintegration/images/btn_prev.png
/usr/share/doc/qt6/qtplatformintegration/images/bullet_dn.png
/usr/share/doc/qt6/qtplatformintegration/images/bullet_sq.png
/usr/share/doc/qt6/qtplatformintegration/images/home.png
/usr/share/doc/qt6/qtplatformintegration/images/ico_note.png
/usr/share/doc/qt6/qtplatformintegration/images/ico_note_attention.png
/usr/share/doc/qt6/qtplatformintegration/images/ico_out.png
/usr/share/doc/qt6/qtplatformintegration/images/logo.png
/usr/share/doc/qt6/qtplatformintegration/native-interfaces.html
/usr/share/doc/qt6/qtplatformintegration/platform-integration.html
/usr/share/doc/qt6/qtplatformintegration/platform-type-conversions.html
/usr/share/doc/qt6/qtplatformintegration/qnativeinterface.html
/usr/share/doc/qt6/qtplatformintegration/qpa.html
/usr/share/doc/qt6/qtplatformintegration/qtplatformintegration.index
/usr/share/doc/qt6/qtplatformintegration/qtplatformintegration.qhp
/usr/share/doc/qt6/qtplatformintegration/qtplatformintegration.qhp.sha1
/usr/share/doc/qt6/qtplatformintegration/style
/usr/share/doc/qt6/qtplatformintegration/style/offline-dark.css
/usr/share/doc/qt6/qtplatformintegration/style/offline-simple.css
/usr/share/doc/qt6/qtplatformintegration/style/offline.css
/usr/share/doc/qt6/qtpositioning/examples-manifest.xml
/usr/share/doc/qt6/qtpositioning/images
/usr/share/doc/qt6/qtpositioning/images/arrow_bc.png
/usr/share/doc/qt6/qtpositioning/images/bgrContent.png
/usr/share/doc/qt6/qtpositioning/images/btn_next.png
/usr/share/doc/qt6/qtpositioning/images/btn_prev.png
/usr/share/doc/qt6/qtpositioning/images/bullet_dn.png
/usr/share/doc/qt6/qtpositioning/images/bullet_sq.png
/usr/share/doc/qt6/qtpositioning/images/example-weatherinfo.png
/usr/share/doc/qt6/qtpositioning/images/home.png
/usr/share/doc/qt6/qtpositioning/images/ico_note.png
/usr/share/doc/qt6/qtpositioning/images/ico_note_attention.png
/usr/share/doc/qt6/qtpositioning/images/ico_out.png
/usr/share/doc/qt6/qtpositioning/images/logo.png
/usr/share/doc/qt6/qtpositioning/images/permissions.png
/usr/share/doc/qt6/qtpositioning/images/rssiview_settings.webp
/usr/share/doc/qt6/qtpositioning/images/skyview_tableview.webp
/usr/share/doc/qt6/qtpositioning/location-positioning-cpp.html
/usr/share/doc/qt6/qtpositioning/location-positioning-qml.html
/usr/share/doc/qt6/qtpositioning/position-plugin-geoclue2.html
/usr/share/doc/qt6/qtpositioning/position-plugin-gypsy.html
/usr/share/doc/qt6/qtpositioning/position-plugin-nmea.html
/usr/share/doc/qt6/qtpositioning/positioning-cpp-qml.html
/usr/share/doc/qt6/qtpositioning/qgeoaddress-members.html
/usr/share/doc/qt6/qtpositioning/qgeoaddress.html
/usr/share/doc/qt6/qtpositioning/qgeoareamonitorinfo-members.html
/usr/share/doc/qt6/qtpositioning/qgeoareamonitorinfo.html
/usr/share/doc/qt6/qtpositioning/qgeoareamonitorsource-members.html
/usr/share/doc/qt6/qtpositioning/qgeoareamonitorsource.html
/usr/share/doc/qt6/qtpositioning/qgeocircle-members.html
/usr/share/doc/qt6/qtpositioning/qgeocircle.html
/usr/share/doc/qt6/qtpositioning/qgeocoordinate-members.html
/usr/share/doc/qt6/qtpositioning/qgeocoordinate.html
/usr/share/doc/qt6/qtpositioning/qgeolocation-members.html
/usr/share/doc/qt6/qtpositioning/qgeolocation.html
/usr/share/doc/qt6/qtpositioning/qgeopath-members.html
/usr/share/doc/qt6/qtpositioning/qgeopath.html
/usr/share/doc/qt6/qtpositioning/qgeopolygon-members.html
/usr/share/doc/qt6/qtpositioning/qgeopolygon.html
/usr/share/doc/qt6/qtpositioning/qgeopositioninfo-members.html
/usr/share/doc/qt6/qtpositioning/qgeopositioninfo.html
/usr/share/doc/qt6/qtpositioning/qgeopositioninfosource-members.html
/usr/share/doc/qt6/qtpositioning/qgeopositioninfosource.html
/usr/share/doc/qt6/qtpositioning/qgeopositioninfosourcefactory-members.html
/usr/share/doc/qt6/qtpositioning/qgeopositioninfosourcefactory.html
/usr/share/doc/qt6/qtpositioning/qgeorectangle-members.html
/usr/share/doc/qt6/qtpositioning/qgeorectangle.html
/usr/share/doc/qt6/qtpositioning/qgeosatelliteinfo-members.html
/usr/share/doc/qt6/qtpositioning/qgeosatelliteinfo.html
/usr/share/doc/qt6/qtpositioning/qgeosatelliteinfosource-members.html
/usr/share/doc/qt6/qtpositioning/qgeosatelliteinfosource.html
/usr/share/doc/qt6/qtpositioning/qgeoshape-members.html
/usr/share/doc/qt6/qtpositioning/qgeoshape.html
/usr/share/doc/qt6/qtpositioning/qhash-qtpositioning-proxy.html
/usr/share/doc/qt6/qtpositioning/qml-coordinate.html
/usr/share/doc/qt6/qtpositioning/qml-geocircle.html
/usr/share/doc/qt6/qtpositioning/qml-geopath.html
/usr/share/doc/qt6/qtpositioning/qml-geopolygon.html
/usr/share/doc/qt6/qtpositioning/qml-georectangle.html
/usr/share/doc/qt6/qtpositioning/qml-geosatelliteinfo.html
/usr/share/doc/qt6/qtpositioning/qml-geoshape.html
/usr/share/doc/qt6/qtpositioning/qml-qtpositioning-address-members.html
/usr/share/doc/qt6/qtpositioning/qml-qtpositioning-address.html
/usr/share/doc/qt6/qtpositioning/qml-qtpositioning-coordinateanimation-members.html
/usr/share/doc/qt6/qtpositioning/qml-qtpositioning-coordinateanimation.html
/usr/share/doc/qt6/qtpositioning/qml-qtpositioning-location-members.html
/usr/share/doc/qt6/qtpositioning/qml-qtpositioning-location.html
/usr/share/doc/qt6/qtpositioning/qml-qtpositioning-pluginparameter-members.html
/usr/share/doc/qt6/qtpositioning/qml-qtpositioning-pluginparameter.html
/usr/share/doc/qt6/qtpositioning/qml-qtpositioning-position-members.html
/usr/share/doc/qt6/qtpositioning/qml-qtpositioning-position.html
/usr/share/doc/qt6/qtpositioning/qml-qtpositioning-positionsource-members.html
/usr/share/doc/qt6/qtpositioning/qml-qtpositioning-positionsource.html
/usr/share/doc/qt6/qtpositioning/qml-qtpositioning-qtpositioning-members.html
/usr/share/doc/qt6/qtpositioning/qml-qtpositioning-qtpositioning.html
/usr/share/doc/qt6/qtpositioning/qml-qtpositioning-satellitesource-members.html
/usr/share/doc/qt6/qtpositioning/qml-qtpositioning-satellitesource.html
/usr/share/doc/qt6/qtpositioning/qnmeapositioninfosource-members.html
/usr/share/doc/qt6/qtpositioning/qnmeapositioninfosource.html
/usr/share/doc/qt6/qtpositioning/qnmeasatelliteinfosource-members.html
/usr/share/doc/qt6/qtpositioning/qnmeasatelliteinfosource.html
/usr/share/doc/qt6/qtpositioning/qtpositioning-android.html
/usr/share/doc/qt6/qtpositioning/qtpositioning-attribution-clip2tri.html
/usr/share/doc/qt6/qtpositioning/qtpositioning-attribution-clipper.html
/usr/share/doc/qt6/qtpositioning/qtpositioning-attribution-material-symbols-and-icons.html
/usr/share/doc/qt6/qtpositioning/qtpositioning-attribution-poly2tri.html
/usr/share/doc/qt6/qtpositioning/qtpositioning-attribution-titilliumweb-font.html
/usr/share/doc/qt6/qtpositioning/qtpositioning-attribution-weatherinfo-tango-icons.html
/usr/share/doc/qt6/qtpositioning/qtpositioning-attribution-weatherinfo-tango-weather-pack.html
/usr/share/doc/qt6/qtpositioning/qtpositioning-changes-qt6.html
/usr/share/doc/qt6/qtpositioning/qtpositioning-examples.html
/usr/share/doc/qt6/qtpositioning/qtpositioning-index.html
/usr/share/doc/qt6/qtpositioning/qtpositioning-ios.html
/usr/share/doc/qt6/qtpositioning/qtpositioning-logfilepositionsource-example.html
/usr/share/doc/qt6/qtpositioning/qtpositioning-module.html
/usr/share/doc/qt6/qtpositioning/qtpositioning-plugins.html
/usr/share/doc/qt6/qtpositioning/qtpositioning-qmlmodule.html
/usr/share/doc/qt6/qtpositioning/qtpositioning-satelliteinfo-example.html
/usr/share/doc/qt6/qtpositioning/qtpositioning-weatherinfo-example.html
/usr/share/doc/qt6/qtpositioning/qtpositioning.index
/usr/share/doc/qt6/qtpositioning/qtpositioning.qhp
/usr/share/doc/qt6/qtpositioning/qtpositioning.qhp.sha1
/usr/share/doc/qt6/qtpositioning/style
/usr/share/doc/qt6/qtpositioning/style/offline-dark.css
/usr/share/doc/qt6/qtpositioning/style/offline-simple.css
/usr/share/doc/qt6/qtpositioning/style/offline.css
/usr/share/doc/qt6/qtprintsupport/images
/usr/share/doc/qt6/qtprintsupport/images/arrow_bc.png
/usr/share/doc/qt6/qtprintsupport/images/bgrContent.png
/usr/share/doc/qt6/qtprintsupport/images/btn_next.png
/usr/share/doc/qt6/qtprintsupport/images/btn_prev.png
/usr/share/doc/qt6/qtprintsupport/images/bullet_dn.png
/usr/share/doc/qt6/qtprintsupport/images/bullet_sq.png
/usr/share/doc/qt6/qtprintsupport/images/home.png
/usr/share/doc/qt6/qtprintsupport/images/ico_note.png
/usr/share/doc/qt6/qtprintsupport/images/ico_note_attention.png
/usr/share/doc/qt6/qtprintsupport/images/ico_out.png
/usr/share/doc/qt6/qtprintsupport/images/logo.png
/usr/share/doc/qt6/qtprintsupport/images/plastique-printdialog-properties.png
/usr/share/doc/qt6/qtprintsupport/images/plastique-printdialog.png
/usr/share/doc/qt6/qtprintsupport/images/printer-rects.png
/usr/share/doc/qt6/qtprintsupport/pdf-licensing.html
/usr/share/doc/qt6/qtprintsupport/printing.html
/usr/share/doc/qt6/qtprintsupport/printsupport-changes-qt6.html
/usr/share/doc/qt6/qtprintsupport/qabstractprintdialog-members.html
/usr/share/doc/qt6/qtprintsupport/qabstractprintdialog.html
/usr/share/doc/qt6/qtprintsupport/qpagesetupdialog-members.html
/usr/share/doc/qt6/qtprintsupport/qpagesetupdialog.html
/usr/share/doc/qt6/qtprintsupport/qprintdialog-members.html
/usr/share/doc/qt6/qtprintsupport/qprintdialog.html
/usr/share/doc/qt6/qtprintsupport/qprintengine-members.html
/usr/share/doc/qt6/qtprintsupport/qprintengine.html
/usr/share/doc/qt6/qtprintsupport/qprinter-members.html
/usr/share/doc/qt6/qtprintsupport/qprinter.html
/usr/share/doc/qt6/qtprintsupport/qprinterinfo-members.html
/usr/share/doc/qt6/qtprintsupport/qprinterinfo.html
/usr/share/doc/qt6/qtprintsupport/qprintpreviewdialog-members.html
/usr/share/doc/qt6/qtprintsupport/qprintpreviewdialog.html
/usr/share/doc/qt6/qtprintsupport/qprintpreviewwidget-members.html
/usr/share/doc/qt6/qtprintsupport/qprintpreviewwidget.html
/usr/share/doc/qt6/qtprintsupport/qtprintsupport-index.html
/usr/share/doc/qt6/qtprintsupport/qtprintsupport-module.html
/usr/share/doc/qt6/qtprintsupport/qtprintsupport.index
/usr/share/doc/qt6/qtprintsupport/qtprintsupport.qhp
/usr/share/doc/qt6/qtprintsupport/qtprintsupport.qhp.sha1
/usr/share/doc/qt6/qtprintsupport/style
/usr/share/doc/qt6/qtprintsupport/style/offline-dark.css
/usr/share/doc/qt6/qtprintsupport/style/offline-simple.css
/usr/share/doc/qt6/qtprintsupport/style/offline.css
/usr/share/doc/qt6/qtprotobuf/cmake-commands-qtprotobuf.html
/usr/share/doc/qt6/qtprotobuf/examples-manifest.xml
/usr/share/doc/qt6/qtprotobuf/images
/usr/share/doc/qt6/qtprotobuf/images/arrow_bc.png
/usr/share/doc/qt6/qtprotobuf/images/bgrContent.png
/usr/share/doc/qt6/qtprotobuf/images/btn_next.png
/usr/share/doc/qt6/qtprotobuf/images/btn_prev.png
/usr/share/doc/qt6/qtprotobuf/images/bullet_dn.png
/usr/share/doc/qt6/qtprotobuf/images/bullet_sq.png
/usr/share/doc/qt6/qtprotobuf/images/client.webp
/usr/share/doc/qt6/qtprotobuf/images/emulator.webp
/usr/share/doc/qt6/qtprotobuf/images/home.png
/usr/share/doc/qt6/qtprotobuf/images/ico_note.png
/usr/share/doc/qt6/qtprotobuf/images/ico_note_attention.png
/usr/share/doc/qt6/qtprotobuf/images/ico_out.png
/usr/share/doc/qt6/qtprotobuf/images/logo.png
/usr/share/doc/qt6/qtprotobuf/images/msvc-kit.webp
/usr/share/doc/qt6/qtprotobuf/images/path-env-variable.webp
/usr/share/doc/qt6/qtprotobuf/images/qt-creator.webp
/usr/share/doc/qt6/qtprotobuf/protobuf.html
/usr/share/doc/qt6/qtprotobuf/qabstractprotobufserializer-members.html
/usr/share/doc/qt6/qtprotobuf/qabstractprotobufserializer.html
/usr/share/doc/qt6/qtprotobuf/qprotobufmessage-members.html
/usr/share/doc/qt6/qtprotobuf/qprotobufmessage.html
/usr/share/doc/qt6/qtprotobuf/qprotobufmessagedeleter-members.html
/usr/share/doc/qt6/qtprotobuf/qprotobufmessagedeleter.html
/usr/share/doc/qt6/qtprotobuf/qprotobufserializer-members.html
/usr/share/doc/qt6/qtprotobuf/qprotobufserializer.html
/usr/share/doc/qt6/qtprotobuf/qt-add-protobuf.html
/usr/share/doc/qt6/qtprotobuf/qtgrpcgen-qt-tool.html
/usr/share/doc/qt6/qtprotobuf/qtprotobuf-any-members.html
/usr/share/doc/qt6/qtprotobuf/qtprotobuf-any.html
/usr/share/doc/qt6/qtprotobuf/qtprotobuf-attribution-protobuf.html
/usr/share/doc/qt6/qtprotobuf/qtprotobuf-examples.html
/usr/share/doc/qt6/qtprotobuf/qtprotobuf-index.html
/usr/share/doc/qt6/qtprotobuf/qtprotobuf-module.html
/usr/share/doc/qt6/qtprotobuf/qtprotobuf-sensors-example.html
/usr/share/doc/qt6/qtprotobuf/qtprotobuf.html
/usr/share/doc/qt6/qtprotobuf/qtprotobuf.index
/usr/share/doc/qt6/qtprotobuf/qtprotobuf.qhp
/usr/share/doc/qt6/qtprotobuf/qtprotobuf.qhp.sha1
/usr/share/doc/qt6/qtprotobuf/qtprotobufgen-qt-tool.html
/usr/share/doc/qt6/qtprotobuf/qtprotobufqtcoretypes-module.html
/usr/share/doc/qt6/qtprotobuf/qtprotobufqtguitypes-module.html
/usr/share/doc/qt6/qtprotobuf/qtprotobufwellknowntypes-module.html
/usr/share/doc/qt6/qtprotobuf/style
/usr/share/doc/qt6/qtprotobuf/style/offline-dark.css
/usr/share/doc/qt6/qtprotobuf/style/offline-simple.css
/usr/share/doc/qt6/qtprotobuf/style/offline.css
/usr/share/doc/qt6/qtqml/cmake-global-properties-qtqml.html
/usr/share/doc/qt6/qtqml/cmake-global-property-qt-qmllinter-targets-folder.html
/usr/share/doc/qt6/qtqml/cmake-source-file-properties-qtqml.html
/usr/share/doc/qt6/qtqml/cmake-source-file-property-qt-qml-internal-type.html
/usr/share/doc/qt6/qtqml/cmake-source-file-property-qt-qml-singleton-type.html
/usr/share/doc/qt6/qtqml/cmake-source-file-property-qt-qml-skip-cachegen.html
/usr/share/doc/qt6/qtqml/cmake-source-file-property-qt-qml-skip-qmldir-entry.html
/usr/share/doc/qt6/qtqml/cmake-source-file-property-qt-qml-skip-qmllint.html
/usr/share/doc/qt6/qtqml/cmake-source-file-property-qt-qml-skip-type-compiler.html
/usr/share/doc/qt6/qtqml/cmake-source-file-property-qt-qml-source-typename.html
/usr/share/doc/qt6/qtqml/cmake-source-file-property-qt-qml-source-versions.html
/usr/share/doc/qt6/qtqml/cmake-source-file-property-qt-qmltc-file-basename.html
/usr/share/doc/qt6/qtqml/cmake-variable-qt-qml-output-directory.html
/usr/share/doc/qt6/qtqml/examples-manifest.xml
/usr/share/doc/qt6/qtqml/images
/usr/share/doc/qt6/qtqml/images/arrow_bc.png
/usr/share/doc/qt6/qtqml/images/bgrContent.png
/usr/share/doc/qt6/qtqml/images/btn_next.png
/usr/share/doc/qt6/qtqml/images/btn_prev.png
/usr/share/doc/qt6/qtqml/images/bullet_dn.png
/usr/share/doc/qt6/qtqml/images/bullet_sq.png
/usr/share/doc/qt6/qtqml/images/button-types.png
/usr/share/doc/qt6/qtqml/images/cpp-qml-integration-flowchart.png
/usr/share/doc/qt6/qtqml/images/declarative-rect_tint.png
/usr/share/doc/qt6/qtqml/images/documents-definetypes-attributes.png
/usr/share/doc/qt6/qtqml/images/documents-definetypes-simple.png
/usr/share/doc/qt6/qtqml/images/extending-qml-advanced-word-cloud.png
/usr/share/doc/qt6/qtqml/images/extending-tutorial-chapter1.png
/usr/share/doc/qt6/qtqml/images/extending-tutorial-chapter2.png
/usr/share/doc/qt6/qtqml/images/extending-tutorial-chapter3.png
/usr/share/doc/qt6/qtqml/images/extending-tutorial-chapter5.png
/usr/share/doc/qt6/qtqml/images/home.png
/usr/share/doc/qt6/qtqml/images/ico_note.png
/usr/share/doc/qt6/qtqml/images/ico_note_attention.png
/usr/share/doc/qt6/qtqml/images/ico_out.png
/usr/share/doc/qt6/qtqml/images/logo.png
/usr/share/doc/qt6/qtqml/images/qml-dynamicscene-example.png
/usr/share/doc/qt6/qtqml/images/qml-i18n-example.png
/usr/share/doc/qt6/qtqml/images/qmlsc-compilation-scheme.png
/usr/share/doc/qt6/qtqml/images/qmltc-compilation-scheme.png
/usr/share/doc/qt6/qtqml/images/qtqml-syntax-basics-object-declaration.png
/usr/share/doc/qt6/qtqml/qjsengine-members.html
/usr/share/doc/qt6/qtqml/qjsengine.html
/usr/share/doc/qt6/qtqml/qjsmanagedvalue-members.html
/usr/share/doc/qt6/qtqml/qjsmanagedvalue.html
/usr/share/doc/qt6/qtqml/qjsprimitivenull.html
/usr/share/doc/qt6/qtqml/qjsprimitiveundefined.html
/usr/share/doc/qt6/qtqml/qjsprimitivevalue-members.html
/usr/share/doc/qt6/qtqml/qjsprimitivevalue.html
/usr/share/doc/qt6/qtqml/qjsvalue-members.html
/usr/share/doc/qt6/qtqml/qjsvalue.html
/usr/share/doc/qt6/qtqml/qjsvalueiterator-members.html
/usr/share/doc/qt6/qtqml/qjsvalueiterator.html
/usr/share/doc/qt6/qtqml/qml-bool.html
/usr/share/doc/qt6/qtqml/qml-changes-qt6.html
/usr/share/doc/qt6/qtqml/qml-date.html
/usr/share/doc/qt6/qtqml/qml-double.html
/usr/share/doc/qt6/qtqml/qml-enumeration.html
/usr/share/doc/qt6/qtqml/qml-int.html
/usr/share/doc/qt6/qtqml/qml-list.html
/usr/share/doc/qt6/qtqml/qml-point.html
/usr/share/doc/qt6/qtqml/qml-qtqml-binding-members.html
/usr/share/doc/qt6/qtqml/qml-qtqml-binding.html
/usr/share/doc/qt6/qtqml/qml-qtqml-component-members.html
/usr/share/doc/qt6/qtqml/qml-qtqml-component.html
/usr/share/doc/qt6/qtqml/qml-qtqml-connections-members.html
/usr/share/doc/qt6/qtqml/qml-qtqml-connections.html
/usr/share/doc/qt6/qtqml/qml-qtqml-date-members.html
/usr/share/doc/qt6/qtqml/qml-qtqml-date.html
/usr/share/doc/qt6/qtqml/qml-qtqml-locale-members.html
/usr/share/doc/qt6/qtqml/qml-qtqml-locale-obsolete.html
/usr/share/doc/qt6/qtqml/qml-qtqml-locale.html
/usr/share/doc/qt6/qtqml/qml-qtqml-loggingcategory-members.html
/usr/share/doc/qt6/qtqml/qml-qtqml-loggingcategory.html
/usr/share/doc/qt6/qtqml/qml-qtqml-number-members.html
/usr/share/doc/qt6/qtqml/qml-qtqml-number.html
/usr/share/doc/qt6/qtqml/qml-qtqml-qt-members.html
/usr/share/doc/qt6/qtqml/qml-qtqml-qt-obsolete.html
/usr/share/doc/qt6/qtqml/qml-qtqml-qt.html
/usr/share/doc/qt6/qtqml/qml-qtqml-qtobject-members.html
/usr/share/doc/qt6/qtqml/qml-qtqml-qtobject.html
/usr/share/doc/qt6/qtqml/qml-qtqml-timer-members.html
/usr/share/doc/qt6/qtqml/qml-qtqml-timer.html
/usr/share/doc/qt6/qtqml/qml-qtqml-xmlhttprequest-members.html
/usr/share/doc/qt6/qtqml/qml-qtqml-xmlhttprequest.html
/usr/share/doc/qt6/qtqml/qml-real.html
/usr/share/doc/qt6/qtqml/qml-rect.html
/usr/share/doc/qt6/qtqml/qml-size.html
/usr/share/doc/qt6/qtqml/qml-string.html
/usr/share/doc/qt6/qtqml/qml-url.html
/usr/share/doc/qt6/qtqml/qml-var.html
/usr/share/doc/qt6/qtqml/qml-variant.html
/usr/share/doc/qt6/qtqml/qml-void.html
/usr/share/doc/qt6/qtqml/qmldiskcache.html
/usr/share/doc/qt6/qtqml/qmlreference.html
/usr/share/doc/qt6/qtqml/qqmlabstracturlinterceptor-members.html
/usr/share/doc/qt6/qtqml/qqmlabstracturlinterceptor.html
/usr/share/doc/qt6/qtqml/qqmlapplicationengine-members.html
/usr/share/doc/qt6/qtqml/qqmlapplicationengine.html
/usr/share/doc/qt6/qtqml/qqmlcomponent-members.html
/usr/share/doc/qt6/qtqml/qqmlcomponent.html
/usr/share/doc/qt6/qtqml/qqmlcontext-members.html
/usr/share/doc/qt6/qtqml/qqmlcontext-propertypair.html
/usr/share/doc/qt6/qtqml/qqmlcontext.html
/usr/share/doc/qt6/qtqml/qqmlengine-members.html
/usr/share/doc/qt6/qtqml/qqmlengine-obsolete.html
/usr/share/doc/qt6/qtqml/qqmlengine.html
/usr/share/doc/qt6/qtqml/qqmlengineextensionplugin-members.html
/usr/share/doc/qt6/qtqml/qqmlengineextensionplugin.html
/usr/share/doc/qt6/qtqml/qqmlerror-members.html
/usr/share/doc/qt6/qtqml/qqmlerror.html
/usr/share/doc/qt6/qtqml/qqmlexpression-members.html
/usr/share/doc/qt6/qtqml/qqmlexpression.html
/usr/share/doc/qt6/qtqml/qqmlextensionplugin-members.html
/usr/share/doc/qt6/qtqml/qqmlextensionplugin.html
/usr/share/doc/qt6/qtqml/qqmlfileselector-members.html
/usr/share/doc/qt6/qtqml/qqmlfileselector-obsolete.html
/usr/share/doc/qt6/qtqml/qqmlfileselector.html
/usr/share/doc/qt6/qtqml/qqmlimageproviderbase-members.html
/usr/share/doc/qt6/qtqml/qqmlimageproviderbase.html
/usr/share/doc/qt6/qtqml/qqmlincubationcontroller-members.html
/usr/share/doc/qt6/qtqml/qqmlincubationcontroller.html
/usr/share/doc/qt6/qtqml/qqmlincubator-members.html
/usr/share/doc/qt6/qtqml/qqmlincubator.html
/usr/share/doc/qt6/qtqml/qqmlinfo-members.html
/usr/share/doc/qt6/qtqml/qqmlinfo.html
/usr/share/doc/qt6/qtqml/qqmllistproperty-members.html
/usr/share/doc/qt6/qtqml/qqmllistproperty-obsolete.html
/usr/share/doc/qt6/qtqml/qqmllistproperty.html
/usr/share/doc/qt6/qtqml/qqmllistreference-members.html
/usr/share/doc/qt6/qtqml/qqmllistreference-obsolete.html
/usr/share/doc/qt6/qtqml/qqmllistreference.html
/usr/share/doc/qt6/qtqml/qqmlnetworkaccessmanagerfactory-members.html
/usr/share/doc/qt6/qtqml/qqmlnetworkaccessmanagerfactory.html
/usr/share/doc/qt6/qtqml/qqmlparserstatus-members.html
/usr/share/doc/qt6/qtqml/qqmlparserstatus.html
/usr/share/doc/qt6/qtqml/qqmlproperty-members.html
/usr/share/doc/qt6/qtqml/qqmlproperty.html
/usr/share/doc/qt6/qtqml/qqmlpropertymap-members.html
/usr/share/doc/qt6/qtqml/qqmlpropertymap.html
/usr/share/doc/qt6/qtqml/qqmlpropertyvaluesource-members.html
/usr/share/doc/qt6/qtqml/qqmlpropertyvaluesource.html
/usr/share/doc/qt6/qtqml/qqmlscriptstring-members.html
/usr/share/doc/qt6/qtqml/qqmlscriptstring.html
/usr/share/doc/qt6/qtqml/qt-add-qml-module.html
/usr/share/doc/qt6/qtqml/qt-add-qml-plugin.html
/usr/share/doc/qt6/qtqml/qt-cmake-policy-qtp0001.html
/usr/share/doc/qt6/qtqml/qt-deploy-qml-imports.html
/usr/share/doc/qt6/qtqml/qt-generate-deploy-qml-app-script.html
/usr/share/doc/qt6/qtqml/qt-generate-foreign-qml-types.html
/usr/share/doc/qt6/qtqml/qt-import-qml-plugins.html
/usr/share/doc/qt6/qtqml/qt-query-qml-module.html
/usr/share/doc/qt6/qtqml/qt-target-compile-qml-to-cpp.html
/usr/share/doc/qt6/qtqml/qt-target-qml-sources.html
/usr/share/doc/qt6/qtqml/qtjavascript.html
/usr/share/doc/qt6/qtqml/qtqml-attribution-masm.html
/usr/share/doc/qt6/qtqml/qtqml-cppclasses-topic.html
/usr/share/doc/qt6/qtqml/qtqml-cppintegration-contextproperties.html
/usr/share/doc/qt6/qtqml/qtqml-cppintegration-data.html
/usr/share/doc/qt6/qtqml/qtqml-cppintegration-definetypes.html
/usr/share/doc/qt6/qtqml/qtqml-cppintegration-exposecppattributes.html
/usr/share/doc/qt6/qtqml/qtqml-cppintegration-exposecppstate.html
/usr/share/doc/qt6/qtqml/qtqml-cppintegration-interactqmlfromcpp.html
/usr/share/doc/qt6/qtqml/qtqml-cppintegration-overview.html
/usr/share/doc/qt6/qtqml/qtqml-documents-definetypes.html
/usr/share/doc/qt6/qtqml/qtqml-documents-networktransparency.html
/usr/share/doc/qt6/qtqml/qtqml-documents-scope.html
/usr/share/doc/qt6/qtqml/qtqml-documents-structure.html
/usr/share/doc/qt6/qtqml/qtqml-documents-topic.html
/usr/share/doc/qt6/qtqml/qtqml-dynamicscene-example.html
/usr/share/doc/qt6/qtqml/qtqml-index.html
/usr/share/doc/qt6/qtqml/qtqml-integrating-with-js-values-from-cpp.html
/usr/share/doc/qt6/qtqml/qtqml-javascript-dynamicobjectcreation.html
/usr/share/doc/qt6/qtqml/qtqml-javascript-expressions.html
/usr/share/doc/qt6/qtqml/qtqml-javascript-finetuning.html
/usr/share/doc/qt6/qtqml/qtqml-javascript-functionlist.html
/usr/share/doc/qt6/qtqml/qtqml-javascript-hostenvironment.html
/usr/share/doc/qt6/qtqml/qtqml-javascript-imports.html
/usr/share/doc/qt6/qtqml/qtqml-javascript-memory.html
/usr/share/doc/qt6/qtqml/qtqml-javascript-qmlglobalobject.html
/usr/share/doc/qt6/qtqml/qtqml-javascript-resources.html
/usr/share/doc/qt6/qtqml/qtqml-javascript-topic.html
/usr/share/doc/qt6/qtqml/qtqml-module.html
/usr/share/doc/qt6/qtqml/qtqml-modules-cppplugins.html
/usr/share/doc/qt6/qtqml/qtqml-modules-identifiedmodules.html
/usr/share/doc/qt6/qtqml/qtqml-modules-legacymodules.html
/usr/share/doc/qt6/qtqml/qtqml-modules-qmldir.html
/usr/share/doc/qt6/qtqml/qtqml-modules-topic.html
/usr/share/doc/qt6/qtqml/qtqml-qml-i18n-example.html
/usr/share/doc/qt6/qtqml/qtqml-qml-script-compiler.html
/usr/share/doc/qt6/qtqml/qtqml-qml-type-compiler.html
/usr/share/doc/qt6/qtqml/qtqml-qmlmodule.html
/usr/share/doc/qt6/qtqml/qtqml-qtquick-compiler-tech.html
/usr/share/doc/qt6/qtqml/qtqml-syntax-basics.html
/usr/share/doc/qt6/qtqml/qtqml-syntax-directoryimports.html
/usr/share/doc/qt6/qtqml/qtqml-syntax-imports.html
/usr/share/doc/qt6/qtqml/qtqml-syntax-objectattributes.html
/usr/share/doc/qt6/qtqml/qtqml-syntax-propertybinding.html
/usr/share/doc/qt6/qtqml/qtqml-syntax-signals.html
/usr/share/doc/qt6/qtqml/qtqml-tool-qmlcachegen.html
/usr/share/doc/qt6/qtqml/qtqml-tutorials-extending-qml-advanced-example.html
/usr/share/doc/qt6/qtqml/qtqml-tutorials-extending-qml-example.html
/usr/share/doc/qt6/qtqml/qtqml-typesystem-basictypes.html
/usr/share/doc/qt6/qtqml/qtqml-typesystem-namespaces.html
/usr/share/doc/qt6/qtqml/qtqml-typesystem-objecttypes.html
/usr/share/doc/qt6/qtqml/qtqml-typesystem-topic.html
/usr/share/doc/qt6/qtqml/qtqml-typesystem-valuetypes.html
/usr/share/doc/qt6/qtqml/qtqml-writing-a-module.html
/usr/share/doc/qt6/qtqml/qtqml.index
/usr/share/doc/qt6/qtqml/qtqml.qhp
/usr/share/doc/qt6/qtqml/qtqml.qhp.sha1
/usr/share/doc/qt6/qtqml/style
/usr/share/doc/qt6/qtqml/style/offline-dark.css
/usr/share/doc/qt6/qtqml/style/offline-simple.css
/usr/share/doc/qt6/qtqml/style/offline.css
/usr/share/doc/qt6/qtqmlcompiler/images
/usr/share/doc/qt6/qtqmlcompiler/images/arrow_bc.png
/usr/share/doc/qt6/qtqmlcompiler/images/bgrContent.png
/usr/share/doc/qt6/qtqmlcompiler/images/btn_next.png
/usr/share/doc/qt6/qtqmlcompiler/images/btn_prev.png
/usr/share/doc/qt6/qtqmlcompiler/images/bullet_dn.png
/usr/share/doc/qt6/qtqmlcompiler/images/bullet_sq.png
/usr/share/doc/qt6/qtqmlcompiler/images/home.png
/usr/share/doc/qt6/qtqmlcompiler/images/ico_note.png
/usr/share/doc/qt6/qtqmlcompiler/images/ico_note_attention.png
/usr/share/doc/qt6/qtqmlcompiler/images/ico_out.png
/usr/share/doc/qt6/qtqmlcompiler/images/logo.png
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-binding-bindings-members.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-binding-bindings.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-binding-members.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-binding.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-element-members.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-element.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-elementpass-members.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-elementpass.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-fixsuggestion-members.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-fixsuggestion.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-genericpass-members.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-genericpass.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-lintplugin-members.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-lintplugin.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-loggerwarningid.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-method-members.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-method-methods-members.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-method-methods.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-method.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-passmanager-members.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-passmanager.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-property-members.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-property.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-propertypass-members.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-propertypass.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-sourcelocation-members.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-sourcelocation.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-tutorial.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-tutorial1.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-tutorial2.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa-tutorial3.html
/usr/share/doc/qt6/qtqmlcompiler/qqmlsa.html
/usr/share/doc/qt6/qtqmlcompiler/qtqmlcompiler-index.html
/usr/share/doc/qt6/qtqmlcompiler/qtqmlcompiler-module.html
/usr/share/doc/qt6/qtqmlcompiler/qtqmlcompiler.index
/usr/share/doc/qt6/qtqmlcompiler/qtqmlcompiler.qhp
/usr/share/doc/qt6/qtqmlcompiler/qtqmlcompiler.qhp.sha1
/usr/share/doc/qt6/qtqmlcompiler/style
/usr/share/doc/qt6/qtqmlcompiler/style/offline-dark.css
/usr/share/doc/qt6/qtqmlcompiler/style/offline-simple.css
/usr/share/doc/qt6/qtqmlcompiler/style/offline.css
/usr/share/doc/qt6/qtqmlcore/images
/usr/share/doc/qt6/qtqmlcore/images/arrow_bc.png
/usr/share/doc/qt6/qtqmlcore/images/bgrContent.png
/usr/share/doc/qt6/qtqmlcore/images/btn_next.png
/usr/share/doc/qt6/qtqmlcore/images/btn_prev.png
/usr/share/doc/qt6/qtqmlcore/images/bullet_dn.png
/usr/share/doc/qt6/qtqmlcore/images/bullet_sq.png
/usr/share/doc/qt6/qtqmlcore/images/home.png
/usr/share/doc/qt6/qtqmlcore/images/ico_note.png
/usr/share/doc/qt6/qtqmlcore/images/ico_note_attention.png
/usr/share/doc/qt6/qtqmlcore/images/ico_out.png
/usr/share/doc/qt6/qtqmlcore/images/logo.png
/usr/share/doc/qt6/qtqmlcore/qml-application-permissions.html
/usr/share/doc/qt6/qtqmlcore/qml-qtcore-bluetoothpermission-members.html
/usr/share/doc/qt6/qtqmlcore/qml-qtcore-bluetoothpermission.html
/usr/share/doc/qt6/qtqmlcore/qml-qtcore-calendarpermission-members.html
/usr/share/doc/qt6/qtqmlcore/qml-qtcore-calendarpermission.html
/usr/share/doc/qt6/qtqmlcore/qml-qtcore-camerapermission-members.html
/usr/share/doc/qt6/qtqmlcore/qml-qtcore-camerapermission.html
/usr/share/doc/qt6/qtqmlcore/qml-qtcore-contactspermission-members.html
/usr/share/doc/qt6/qtqmlcore/qml-qtcore-contactspermission.html
/usr/share/doc/qt6/qtqmlcore/qml-qtcore-locationpermission-members.html
/usr/share/doc/qt6/qtqmlcore/qml-qtcore-locationpermission.html
/usr/share/doc/qt6/qtqmlcore/qml-qtcore-microphonepermission-members.html
/usr/share/doc/qt6/qtqmlcore/qml-qtcore-microphonepermission.html
/usr/share/doc/qt6/qtqmlcore/qml-qtcore-settings-members.html
/usr/share/doc/qt6/qtqmlcore/qml-qtcore-settings.html
/usr/share/doc/qt6/qtqmlcore/qml-qtcore-standardpaths-members.html
/usr/share/doc/qt6/qtqmlcore/qml-qtcore-standardpaths.html
/usr/share/doc/qt6/qtqmlcore/qml-qtcore-systeminformation-members.html
/usr/share/doc/qt6/qtqmlcore/qml-qtcore-systeminformation.html
/usr/share/doc/qt6/qtqmlcore/qtcore-qmlmodule.html
/usr/share/doc/qt6/qtqmlcore/qtqmlcore-index.html
/usr/share/doc/qt6/qtqmlcore/qtqmlcore.index
/usr/share/doc/qt6/qtqmlcore/qtqmlcore.qhp
/usr/share/doc/qt6/qtqmlcore/qtqmlcore.qhp.sha1
/usr/share/doc/qt6/qtqmlcore/style
/usr/share/doc/qt6/qtqmlcore/style/offline-dark.css
/usr/share/doc/qt6/qtqmlcore/style/offline-simple.css
/usr/share/doc/qt6/qtqmlcore/style/offline.css
/usr/share/doc/qt6/qtqmlmodels/images
/usr/share/doc/qt6/qtqmlmodels/images/arrow_bc.png
/usr/share/doc/qt6/qtqmlmodels/images/bgrContent.png
/usr/share/doc/qt6/qtqmlmodels/images/btn_next.png
/usr/share/doc/qt6/qtqmlmodels/images/btn_prev.png
/usr/share/doc/qt6/qtqmlmodels/images/bullet_dn.png
/usr/share/doc/qt6/qtqmlmodels/images/bullet_sq.png
/usr/share/doc/qt6/qtqmlmodels/images/home.png
/usr/share/doc/qt6/qtqmlmodels/images/ico_note.png
/usr/share/doc/qt6/qtqmlmodels/images/ico_note_attention.png
/usr/share/doc/qt6/qtqmlmodels/images/ico_out.png
/usr/share/doc/qt6/qtqmlmodels/images/listmodel-nested.png
/usr/share/doc/qt6/qtqmlmodels/images/listmodel.png
/usr/share/doc/qt6/qtqmlmodels/images/logo.png
/usr/share/doc/qt6/qtqmlmodels/images/objectmodel.png
/usr/share/doc/qt6/qtqmlmodels/qml-qt-labs-qmlmodels-delegatechoice-members.html
/usr/share/doc/qt6/qtqmlmodels/qml-qt-labs-qmlmodels-delegatechoice.html
/usr/share/doc/qt6/qtqmlmodels/qml-qt-labs-qmlmodels-delegatechooser-members.html
/usr/share/doc/qt6/qtqmlmodels/qml-qt-labs-qmlmodels-delegatechooser.html
/usr/share/doc/qt6/qtqmlmodels/qml-qt-labs-qmlmodels-tablemodel-members.html
/usr/share/doc/qt6/qtqmlmodels/qml-qt-labs-qmlmodels-tablemodel.html
/usr/share/doc/qt6/qtqmlmodels/qml-qt-labs-qmlmodels-tablemodelcolumn-members.html
/usr/share/doc/qt6/qtqmlmodels/qml-qt-labs-qmlmodels-tablemodelcolumn.html
/usr/share/doc/qt6/qtqmlmodels/qml-qtqml-models-delegatemodel-members.html
/usr/share/doc/qt6/qtqmlmodels/qml-qtqml-models-delegatemodel.html
/usr/share/doc/qt6/qtqmlmodels/qml-qtqml-models-delegatemodelgroup-members.html
/usr/share/doc/qt6/qtqmlmodels/qml-qtqml-models-delegatemodelgroup.html
/usr/share/doc/qt6/qtqmlmodels/qml-qtqml-models-instantiator-members.html
/usr/share/doc/qt6/qtqmlmodels/qml-qtqml-models-instantiator.html
/usr/share/doc/qt6/qtqmlmodels/qml-qtqml-models-itemselectionmodel-members.html
/usr/share/doc/qt6/qtqmlmodels/qml-qtqml-models-itemselectionmodel.html
/usr/share/doc/qt6/qtqmlmodels/qml-qtqml-models-listelement-members.html
/usr/share/doc/qt6/qtqmlmodels/qml-qtqml-models-listelement.html
/usr/share/doc/qt6/qtqmlmodels/qml-qtqml-models-listmodel-members.html
/usr/share/doc/qt6/qtqmlmodels/qml-qtqml-models-listmodel.html
/usr/share/doc/qt6/qtqmlmodels/qml-qtqml-models-objectmodel-members.html
/usr/share/doc/qt6/qtqmlmodels/qml-qtqml-models-objectmodel.html
/usr/share/doc/qt6/qtqmlmodels/qml-qtqml-models-package-members.html
/usr/share/doc/qt6/qtqmlmodels/qml-qtqml-models-package.html
/usr/share/doc/qt6/qtqmlmodels/qmodelindex-and-related-classes-in-qml.html
/usr/share/doc/qt6/qtqmlmodels/qt-labs-qmlmodels-qmlmodule.html
/usr/share/doc/qt6/qtqmlmodels/qtqml-models-qmlmodule.html
/usr/share/doc/qt6/qtqmlmodels/qtqmlmodels.index
/usr/share/doc/qt6/qtqmlmodels/qtqmlmodels.qhp
/usr/share/doc/qt6/qtqmlmodels/qtqmlmodels.qhp.sha1
/usr/share/doc/qt6/qtqmlmodels/style
/usr/share/doc/qt6/qtqmlmodels/style/offline-dark.css
/usr/share/doc/qt6/qtqmlmodels/style/offline-simple.css
/usr/share/doc/qt6/qtqmlmodels/style/offline.css
/usr/share/doc/qt6/qtqmltest/images
/usr/share/doc/qt6/qtqmltest/images/arrow_bc.png
/usr/share/doc/qt6/qtqmltest/images/bgrContent.png
/usr/share/doc/qt6/qtqmltest/images/btn_next.png
/usr/share/doc/qt6/qtqmltest/images/btn_prev.png
/usr/share/doc/qt6/qtqmltest/images/bullet_dn.png
/usr/share/doc/qt6/qtqmltest/images/bullet_sq.png
/usr/share/doc/qt6/qtqmltest/images/home.png
/usr/share/doc/qt6/qtqmltest/images/ico_note.png
/usr/share/doc/qt6/qtqmltest/images/ico_note_attention.png
/usr/share/doc/qt6/qtqmltest/images/ico_out.png
/usr/share/doc/qt6/qtqmltest/images/logo.png
/usr/share/doc/qt6/qtqmltest/qml-qttest-signalspy-members.html
/usr/share/doc/qt6/qtqmltest/qml-qttest-signalspy.html
/usr/share/doc/qt6/qtqmltest/qml-qttest-testcase-members.html
/usr/share/doc/qt6/qtqmltest/qml-qttest-testcase-obsolete.html
/usr/share/doc/qt6/qtqmltest/qml-qttest-testcase.html
/usr/share/doc/qt6/qtqmltest/qml-qttest-toucheventsequence-members.html
/usr/share/doc/qt6/qtqmltest/qml-qttest-toucheventsequence.html
/usr/share/doc/qt6/qtqmltest/qquicktest-obsolete.html
/usr/share/doc/qt6/qtqmltest/qquicktest.html
/usr/share/doc/qt6/qtqmltest/qtqmltest.index
/usr/share/doc/qt6/qtqmltest/qtqmltest.qhp
/usr/share/doc/qt6/qtqmltest/qtqmltest.qhp.sha1
/usr/share/doc/qt6/qtqmltest/qtquicktest-index.html
/usr/share/doc/qt6/qtqmltest/qtquicktest-module.html
/usr/share/doc/qt6/qtqmltest/qttest-qmlmodule.html
/usr/share/doc/qt6/qtqmltest/quicktest-changes-qt6.html
/usr/share/doc/qt6/qtqmltest/style
/usr/share/doc/qt6/qtqmltest/style/offline-dark.css
/usr/share/doc/qt6/qtqmltest/style/offline-simple.css
/usr/share/doc/qt6/qtqmltest/style/offline.css
/usr/share/doc/qt6/qtqmlworkerscript/images
/usr/share/doc/qt6/qtqmlworkerscript/images/arrow_bc.png
/usr/share/doc/qt6/qtqmlworkerscript/images/bgrContent.png
/usr/share/doc/qt6/qtqmlworkerscript/images/btn_next.png
/usr/share/doc/qt6/qtqmlworkerscript/images/btn_prev.png
/usr/share/doc/qt6/qtqmlworkerscript/images/bullet_dn.png
/usr/share/doc/qt6/qtqmlworkerscript/images/bullet_sq.png
/usr/share/doc/qt6/qtqmlworkerscript/images/home.png
/usr/share/doc/qt6/qtqmlworkerscript/images/ico_note.png
/usr/share/doc/qt6/qtqmlworkerscript/images/ico_note_attention.png
/usr/share/doc/qt6/qtqmlworkerscript/images/ico_out.png
/usr/share/doc/qt6/qtqmlworkerscript/images/logo.png
/usr/share/doc/qt6/qtqmlworkerscript/qml-qtqml-workerscript-workerscript-members.html
/usr/share/doc/qt6/qtqmlworkerscript/qml-qtqml-workerscript-workerscript.html
/usr/share/doc/qt6/qtqmlworkerscript/qtqml-workerscript-qmlmodule.html
/usr/share/doc/qt6/qtqmlworkerscript/qtqmlworkerscript.index
/usr/share/doc/qt6/qtqmlworkerscript/qtqmlworkerscript.qhp
/usr/share/doc/qt6/qtqmlworkerscript/qtqmlworkerscript.qhp.sha1
/usr/share/doc/qt6/qtqmlworkerscript/style
/usr/share/doc/qt6/qtqmlworkerscript/style/offline-dark.css
/usr/share/doc/qt6/qtqmlworkerscript/style/offline-simple.css
/usr/share/doc/qt6/qtqmlworkerscript/style/offline.css
/usr/share/doc/qt6/qtqmlxmllistmodel/images
/usr/share/doc/qt6/qtqmlxmllistmodel/images/arrow_bc.png
/usr/share/doc/qt6/qtqmlxmllistmodel/images/bgrContent.png
/usr/share/doc/qt6/qtqmlxmllistmodel/images/btn_next.png
/usr/share/doc/qt6/qtqmlxmllistmodel/images/btn_prev.png
/usr/share/doc/qt6/qtqmlxmllistmodel/images/bullet_dn.png
/usr/share/doc/qt6/qtqmlxmllistmodel/images/bullet_sq.png
/usr/share/doc/qt6/qtqmlxmllistmodel/images/home.png
/usr/share/doc/qt6/qtqmlxmllistmodel/images/ico_note.png
/usr/share/doc/qt6/qtqmlxmllistmodel/images/ico_note_attention.png
/usr/share/doc/qt6/qtqmlxmllistmodel/images/ico_out.png
/usr/share/doc/qt6/qtqmlxmllistmodel/images/logo.png
/usr/share/doc/qt6/qtqmlxmllistmodel/qml-qtqml-xmllistmodel-xmllistmodel-members.html
/usr/share/doc/qt6/qtqmlxmllistmodel/qml-qtqml-xmllistmodel-xmllistmodel.html
/usr/share/doc/qt6/qtqmlxmllistmodel/qml-qtqml-xmllistmodel-xmllistmodelrole-members.html
/usr/share/doc/qt6/qtqmlxmllistmodel/qml-qtqml-xmllistmodel-xmllistmodelrole.html
/usr/share/doc/qt6/qtqmlxmllistmodel/qtqml-xmllistmodel-qmlmodule.html
/usr/share/doc/qt6/qtqmlxmllistmodel/qtqmlxmllistmodel.index
/usr/share/doc/qt6/qtqmlxmllistmodel/qtqmlxmllistmodel.qhp
/usr/share/doc/qt6/qtqmlxmllistmodel/qtqmlxmllistmodel.qhp.sha1
/usr/share/doc/qt6/qtqmlxmllistmodel/style
/usr/share/doc/qt6/qtqmlxmllistmodel/style/offline-dark.css
/usr/share/doc/qt6/qtqmlxmllistmodel/style/offline-simple.css
/usr/share/doc/qt6/qtqmlxmllistmodel/style/offline.css
/usr/share/doc/qt6/qtquick/examples-manifest.xml
/usr/share/doc/qt6/qtquick/images
/usr/share/doc/qt6/qtquick/images/3d-rotation-axis.png
/usr/share/doc/qt6/qtquick/images/9BcAYDlpuT8.jpg
/usr/share/doc/qt6/qtquick/images/ListViewHorizontal.png
/usr/share/doc/qt6/qtquick/images/anchor_ordering.png
/usr/share/doc/qt6/qtquick/images/anchor_ordering_bad.png
/usr/share/doc/qt6/qtquick/images/anchorchanges.png
/usr/share/doc/qt6/qtquick/images/animatedimageitem.gif
/usr/share/doc/qt6/qtquick/images/animatedsprite-loading-frames.png
/usr/share/doc/qt6/qtquick/images/animatedsprite-loading-interpolated.gif
/usr/share/doc/qt6/qtquick/images/animatedsprite-loading.gif
/usr/share/doc/qt6/qtquick/images/animatedsprite-loading.png
/usr/share/doc/qt6/qtquick/images/arrow_bc.png
/usr/share/doc/qt6/qtquick/images/axisrotation.png
/usr/share/doc/qt6/qtquick/images/bgrContent.png
/usr/share/doc/qt6/qtquick/images/btn_next.png
/usr/share/doc/qt6/qtquick/images/btn_prev.png
/usr/share/doc/qt6/qtquick/images/bullet_dn.png
/usr/share/doc/qt6/qtquick/images/bullet_sq.png
/usr/share/doc/qt6/qtquick/images/columnlayout.png
/usr/share/doc/qt6/qtquick/images/containmentMask-circle.gif
/usr/share/doc/qt6/qtquick/images/containmentMask-shape.gif
/usr/share/doc/qt6/qtquick/images/custom-geometry-example.png
/usr/share/doc/qt6/qtquick/images/custom-material-example.jpg
/usr/share/doc/qt6/qtquick/images/customrendernode-example.jpg
/usr/share/doc/qt6/qtquick/images/d3d11underqml-example.jpg
/usr/share/doc/qt6/qtquick/images/declarative-adv-tutorial1.png
/usr/share/doc/qt6/qtquick/images/declarative-adv-tutorial2.png
/usr/share/doc/qt6/qtquick/images/declarative-adv-tutorial3.png
/usr/share/doc/qt6/qtquick/images/declarative-adv-tutorial4.gif
/usr/share/doc/qt6/qtquick/images/declarative-anchors_example.png
/usr/share/doc/qt6/qtquick/images/declarative-anchors_example2.png
/usr/share/doc/qt6/qtquick/images/declarative-arcdirection.png
/usr/share/doc/qt6/qtquick/images/declarative-arcradius.png
/usr/share/doc/qt6/qtquick/images/declarative-arcrotation.png
/usr/share/doc/qt6/qtquick/images/declarative-colors.png
/usr/share/doc/qt6/qtquick/images/declarative-gridmesh.png
/usr/share/doc/qt6/qtquick/images/declarative-item_opacity1.png
/usr/share/doc/qt6/qtquick/images/declarative-item_opacity2.png
/usr/share/doc/qt6/qtquick/images/declarative-item_stacking1.png
/usr/share/doc/qt6/qtquick/images/declarative-item_stacking2.png
/usr/share/doc/qt6/qtquick/images/declarative-item_stacking3.png
/usr/share/doc/qt6/qtquick/images/declarative-item_stacking4.png
/usr/share/doc/qt6/qtquick/images/declarative-largearc.png
/usr/share/doc/qt6/qtquick/images/declarative-nopercent.png
/usr/share/doc/qt6/qtquick/images/declarative-patharc.png
/usr/share/doc/qt6/qtquick/images/declarative-pathattribute.png
/usr/share/doc/qt6/qtquick/images/declarative-pathcubic.png
/usr/share/doc/qt6/qtquick/images/declarative-pathcurve.png
/usr/share/doc/qt6/qtquick/images/declarative-pathquad.png
/usr/share/doc/qt6/qtquick/images/declarative-pathsvg.png
/usr/share/doc/qt6/qtquick/images/declarative-percent.png
/usr/share/doc/qt6/qtquick/images/declarative-qmlfocus1.png
/usr/share/doc/qt6/qtquick/images/declarative-qmlfocus2.png
/usr/share/doc/qt6/qtquick/images/declarative-qmlfocus3.png
/usr/share/doc/qt6/qtquick/images/declarative-qmlfocus4.png
/usr/share/doc/qt6/qtquick/images/declarative-qmlfocus5.png
/usr/share/doc/qt6/qtquick/images/declarative-qtlogo-preserveaspectcrop.png
/usr/share/doc/qt6/qtquick/images/declarative-qtlogo-preserveaspectfit.png
/usr/share/doc/qt6/qtquick/images/declarative-qtlogo-stretch.png
/usr/share/doc/qt6/qtquick/images/declarative-qtlogo-tile.png
/usr/share/doc/qt6/qtquick/images/declarative-qtlogo-tilehorizontally.png
/usr/share/doc/qt6/qtquick/images/declarative-qtlogo-tilevertically.png
/usr/share/doc/qt6/qtquick/images/declarative-qtlogo.png
/usr/share/doc/qt6/qtquick/images/declarative-rect.png
/usr/share/doc/qt6/qtquick/images/declarative-rect_gradient.png
/usr/share/doc/qt6/qtquick/images/declarative-rotation.png
/usr/share/doc/qt6/qtquick/images/declarative-samegame.png
/usr/share/doc/qt6/qtquick/images/declarative-scale.png
/usr/share/doc/qt6/qtquick/images/declarative-scalegrid.png
/usr/share/doc/qt6/qtquick/images/declarative-shadereffectitem.png
/usr/share/doc/qt6/qtquick/images/declarative-shadereffectsource.png
/usr/share/doc/qt6/qtquick/images/declarative-text.png
/usr/share/doc/qt6/qtquick/images/declarative-textballoons_example.png
/usr/share/doc/qt6/qtquick/images/declarative-textedit.gif
/usr/share/doc/qt6/qtquick/images/declarative-textformat.png
/usr/share/doc/qt6/qtquick/images/declarative-textstyle.png
/usr/share/doc/qt6/qtquick/images/declarative-transformorigin.png
/usr/share/doc/qt6/qtquick/images/declarative-tutorial1.png
/usr/share/doc/qt6/qtquick/images/declarative-tutorial2.png
/usr/share/doc/qt6/qtquick/images/declarative-tutorial3_animation.gif
/usr/share/doc/qt6/qtquick/images/dragReleaseMenu.webp
/usr/share/doc/qt6/qtquick/images/edge1.png
/usr/share/doc/qt6/qtquick/images/edge2.png
/usr/share/doc/qt6/qtquick/images/edge3.png
/usr/share/doc/qt6/qtquick/images/edge4.png
/usr/share/doc/qt6/qtquick/images/edges_qml.png
/usr/share/doc/qt6/qtquick/images/flickable-contentXY-bottom-left.png
/usr/share/doc/qt6/qtquick/images/flickable-contentXY-bottom-right.png
/usr/share/doc/qt6/qtquick/images/flickable-contentXY-resting.png
/usr/share/doc/qt6/qtquick/images/flickable-contentXY-top-left.png
/usr/share/doc/qt6/qtquick/images/flickable-contentXY-top-right.png
/usr/share/doc/qt6/qtquick/images/flickable-rebound.gif
/usr/share/doc/qt6/qtquick/images/flickable.gif
/usr/share/doc/qt6/qtquick/images/flipable.gif
/usr/share/doc/qt6/qtquick/images/fuzzydot.png
/usr/share/doc/qt6/qtquick/images/gameoflife.png
/usr/share/doc/qt6/qtquick/images/glowdot.png
/usr/share/doc/qt6/qtquick/images/graph-example.jpg
/usr/share/doc/qt6/qtquick/images/gridLayout_aligncenter.png
/usr/share/doc/qt6/qtquick/images/gridLayout_aligntop.png
/usr/share/doc/qt6/qtquick/images/gridLayout_aligntopleft.png
/usr/share/doc/qt6/qtquick/images/gridLayout_example.png
/usr/share/doc/qt6/qtquick/images/gridlayout.png
/usr/share/doc/qt6/qtquick/images/gridview-highlight.png
/usr/share/doc/qt6/qtquick/images/gridview-layout-lefttoright-ltr-btt.png
/usr/share/doc/qt6/qtquick/images/gridview-layout-lefttoright-ltr-ttb.png
/usr/share/doc/qt6/qtquick/images/gridview-layout-lefttoright-rtl-btt.png
/usr/share/doc/qt6/qtquick/images/gridview-layout-lefttoright-rtl-ttb.png
/usr/share/doc/qt6/qtquick/images/gridview-layout-toptobottom-ltr-btt.png
/usr/share/doc/qt6/qtquick/images/gridview-layout-toptobottom-ltr-ttb.png
/usr/share/doc/qt6/qtquick/images/gridview-layout-toptobottom-rtl-btt.png
/usr/share/doc/qt6/qtquick/images/gridview-layout-toptobottom-rtl-ttb.png
/usr/share/doc/qt6/qtquick/images/gridview-simple.png
/usr/share/doc/qt6/qtquick/images/home.png
/usr/share/doc/qt6/qtquick/images/horizontalpositioner_example.png
/usr/share/doc/qt6/qtquick/images/how-to-time-picker-dark.png
/usr/share/doc/qt6/qtquick/images/how-to-time-picker-light.png
/usr/share/doc/qt6/qtquick/images/ico_note.png
/usr/share/doc/qt6/qtquick/images/ico_note_attention.png
/usr/share/doc/qt6/qtquick/images/ico_out.png
/usr/share/doc/qt6/qtquick/images/imageprovider.png
/usr/share/doc/qt6/qtquick/images/layout-with-default-spacing.png
/usr/share/doc/qt6/qtquick/images/layoutmirroring.png
/usr/share/doc/qt6/qtquick/images/listview-decorations.png
/usr/share/doc/qt6/qtquick/images/listview-highlight.png
/usr/share/doc/qt6/qtquick/images/listview-layout-bottomtotop.png
/usr/share/doc/qt6/qtquick/images/listview-layout-lefttoright.png
/usr/share/doc/qt6/qtquick/images/listview-layout-righttoleft.png
/usr/share/doc/qt6/qtquick/images/listview-layout-toptobottom.png
/usr/share/doc/qt6/qtquick/images/listview-section.png
/usr/share/doc/qt6/qtquick/images/listview-setup.png
/usr/share/doc/qt6/qtquick/images/listview-simple.png
/usr/share/doc/qt6/qtquick/images/logo.png
/usr/share/doc/qt6/qtquick/images/manual-layout.png
/usr/share/doc/qt6/qtquick/images/margins_qml.png
/usr/share/doc/qt6/qtquick/images/metaltextureimport-example.jpg
/usr/share/doc/qt6/qtquick/images/metalunderqml-example.jpg
/usr/share/doc/qt6/qtquick/images/modelview-overview.png
/usr/share/doc/qt6/qtquick/images/multieffect-example1.png
/usr/share/doc/qt6/qtquick/images/multieffect-example2.png
/usr/share/doc/qt6/qtquick/images/multieffect-example3.png
/usr/share/doc/qt6/qtquick/images/multieffect-example4.png
/usr/share/doc/qt6/qtquick/images/multieffect-example5.png
/usr/share/doc/qt6/qtquick/images/openglunderqml-example.jpg
/usr/share/doc/qt6/qtquick/images/parentchange.png
/usr/share/doc/qt6/qtquick/images/pathitem-code-example.png
/usr/share/doc/qt6/qtquick/images/pathview.gif
/usr/share/doc/qt6/qtquick/images/pointerHandlerMargin.png
/usr/share/doc/qt6/qtquick/images/pointerhandlers-example-fakeflickable.jpg
/usr/share/doc/qt6/qtquick/images/pointerhandlers-example-fling.webp
/usr/share/doc/qt6/qtquick/images/pointerhandlers-example-joystick.jpg
/usr/share/doc/qt6/qtquick/images/pointerhandlers-example-map.webp
/usr/share/doc/qt6/qtquick/images/pointerhandlers-example-mixer.webp
/usr/share/doc/qt6/qtquick/images/pointerhandlers-example-multibutton.webp
/usr/share/doc/qt6/qtquick/images/pointerhandlers-example-piemenu.webp
/usr/share/doc/qt6/qtquick/images/pointerhandlers-example-pinchhandler.webp
/usr/share/doc/qt6/qtquick/images/pointerhandlers-example-pointhandler.webp
/usr/share/doc/qt6/qtquick/images/pointerhandlers-example-taphandler.webp
/usr/share/doc/qt6/qtquick/images/positioner-example.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-inback.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-inbounce.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-incirc.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-incubic.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-inelastic.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-inexpo.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-inoutback.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-inoutbounce.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-inoutcirc.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-inoutcubic.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-inoutelastic.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-inoutexpo.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-inoutquad.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-inoutquart.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-inoutquint.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-inoutsine.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-inquad.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-inquart.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-inquint.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-insine.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-linear.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-outback.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-outbounce.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-outcirc.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-outcubic.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-outelastic.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-outexpo.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-outinback.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-outinbounce.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-outincirc.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-outincubic.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-outinelastic.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-outinexpo.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-outinquad.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-outinquart.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-outinquint.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-outinsine.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-outquad.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-outquart.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-outquint.png
/usr/share/doc/qt6/qtquick/images/qeasingcurve-outsine.png
/usr/share/doc/qt6/qtquick/images/qml-abstractitemmodel-example.png
/usr/share/doc/qt6/qtquick/images/qml-affectors-example.png
/usr/share/doc/qt6/qtquick/images/qml-animations-example.png
/usr/share/doc/qt6/qtquick/images/qml-blending-layered.png
/usr/share/doc/qt6/qtquick/images/qml-blending-nonlayered.png
/usr/share/doc/qt6/qtquick/images/qml-borderimage-normal-image.png
/usr/share/doc/qt6/qtquick/images/qml-borderimage-rounded.png
/usr/share/doc/qt6/qtquick/images/qml-borderimage-scaled.png
/usr/share/doc/qt6/qtquick/images/qml-borderimage-tiled.png
/usr/share/doc/qt6/qtquick/images/qml-canvas-example.png
/usr/share/doc/qt6/qtquick/images/qml-column.png
/usr/share/doc/qt6/qtquick/images/qml-dialcontrol-example.png
/usr/share/doc/qt6/qtquick/images/qml-draganddrop-example.png
/usr/share/doc/qt6/qtquick/images/qml-embeddedinwidgets-example.jpg
/usr/share/doc/qt6/qtquick/images/qml-emitters-example.png
/usr/share/doc/qt6/qtquick/images/qml-flipable-example.png
/usr/share/doc/qt6/qtquick/images/qml-flow-snippet.png
/usr/share/doc/qt6/qtquick/images/qml-flow-text1.png
/usr/share/doc/qt6/qtquick/images/qml-flow-text2.png
/usr/share/doc/qt6/qtquick/images/qml-gradient.png
/usr/share/doc/qt6/qtquick/images/qml-grid-no-spacing.png
/usr/share/doc/qt6/qtquick/images/qml-grid-spacing.png
/usr/share/doc/qt6/qtquick/images/qml-imageelements-example.png
/usr/share/doc/qt6/qtquick/images/qml-imageparticle-example.png
/usr/share/doc/qt6/qtquick/images/qml-imageprovider-example.png
/usr/share/doc/qt6/qtquick/images/qml-item-canvas-arc.png
/usr/share/doc/qt6/qtquick/images/qml-item-canvas-arcTo.png
/usr/share/doc/qt6/qtquick/images/qml-item-canvas-bezierCurveTo.png
/usr/share/doc/qt6/qtquick/images/qml-item-canvas-clip-complex.png
/usr/share/doc/qt6/qtquick/images/qml-item-canvas-context.gif
/usr/share/doc/qt6/qtquick/images/qml-item-canvas-lineDash.png
/usr/share/doc/qt6/qtquick/images/qml-item-canvas-math-rotate.png
/usr/share/doc/qt6/qtquick/images/qml-item-canvas-math.png
/usr/share/doc/qt6/qtquick/images/qml-item-canvas-rotate.png
/usr/share/doc/qt6/qtquick/images/qml-item-canvas-scale.png
/usr/share/doc/qt6/qtquick/images/qml-item-canvas-scalex.png
/usr/share/doc/qt6/qtquick/images/qml-item-canvas-scaley.png
/usr/share/doc/qt6/qtquick/images/qml-item-canvas-skewx.png
/usr/share/doc/qt6/qtquick/images/qml-item-canvas-skewy.png
/usr/share/doc/qt6/qtquick/images/qml-item-canvas-startAngle.png
/usr/share/doc/qt6/qtquick/images/qml-item-canvas-translate.png
/usr/share/doc/qt6/qtquick/images/qml-item-canvas-translatey.png
/usr/share/doc/qt6/qtquick/images/qml-itemvariablerefreshrate-example.png
/usr/share/doc/qt6/qtquick/images/qml-keyinteraction-example.png
/usr/share/doc/qt6/qtquick/images/qml-listview-sections-example.png
/usr/share/doc/qt6/qtquick/images/qml-localstorage-example.png
/usr/share/doc/qt6/qtquick/images/qml-modelviews-example.png
/usr/share/doc/qt6/qtquick/images/qml-mousearea-example.png
/usr/share/doc/qt6/qtquick/images/qml-mousearea-snippet.png
/usr/share/doc/qt6/qtquick/images/qml-multieffectitemswitcher-example.jpg
/usr/share/doc/qt6/qtquick/images/qml-multieffecttestbed-example.jpg
/usr/share/doc/qt6/qtquick/images/qml-objectlistmodel-example.png
/usr/share/doc/qt6/qtquick/images/qml-positioners-example.png
/usr/share/doc/qt6/qtquick/images/qml-row.png
/usr/share/doc/qt6/qtquick/images/qml-shadereffect-layereffect.png
/usr/share/doc/qt6/qtquick/images/qml-shadereffect-nolayereffect.png
/usr/share/doc/qt6/qtquick/images/qml-shadereffect-opacitymask.png
/usr/share/doc/qt6/qtquick/images/qml-shadereffects-example.png
/usr/share/doc/qt6/qtquick/images/qml-shapes-example.png
/usr/share/doc/qt6/qtquick/images/qml-stringlistmodel-example.png
/usr/share/doc/qt6/qtquick/images/qml-system-example.png
/usr/share/doc/qt6/qtquick/images/qml-text-example.png
/usr/share/doc/qt6/qtquick/images/qml-window-example.png
/usr/share/doc/qt6/qtquick/images/qquickwidgetversuswindow-opengl-example.jpg
/usr/share/doc/qt6/qtquick/images/qt-pixelator.png
/usr/share/doc/qt6/qtquick/images/qtlabs-wavefrontmesh.png
/usr/share/doc/qt6/qtquick/images/qtquickcontrols-gallery-welcome.png
/usr/share/doc/qt6/qtquick/images/qtquicklayouts-example-layouts.png
/usr/share/doc/qt6/qtquick/images/qtquicklayouts-example-responsivelayouts.png
/usr/share/doc/qt6/qtquick/images/qtquickwidgets-example.png
/usr/share/doc/qt6/qtquick/images/rect-color.png
/usr/share/doc/qt6/qtquick/images/rendercontrol-d3d11-example.jpg
/usr/share/doc/qt6/qtquick/images/rendercontrol-opengl-example.jpg
/usr/share/doc/qt6/qtquick/images/repeater-index.png
/usr/share/doc/qt6/qtquick/images/repeater-modeldata.png
/usr/share/doc/qt6/qtquick/images/repeater-simple.png
/usr/share/doc/qt6/qtquick/images/repeater.png
/usr/share/doc/qt6/qtquick/images/rhitextureitem-example.jpg
/usr/share/doc/qt6/qtquick/images/rhiunderqml-example.jpg
/usr/share/doc/qt6/qtquick/images/rowlayout-minimum.png
/usr/share/doc/qt6/qtquick/images/rowlayout.png
/usr/share/doc/qt6/qtquick/images/screen-and-window-dimensions.jpg
/usr/share/doc/qt6/qtquick/images/sg-renderloop-singlethreaded.png
/usr/share/doc/qt6/qtquick/images/sg-renderloop-threaded.png
/usr/share/doc/qt6/qtquick/images/shape-radial-gradient.png
/usr/share/doc/qt6/qtquick/images/simpleProxy.png
/usr/share/doc/qt6/qtquick/images/spritecutting.png
/usr/share/doc/qt6/qtquick/images/spriteenginegraph.png
/usr/share/doc/qt6/qtquick/images/star.png
/usr/share/doc/qt6/qtquick/images/tapHandlerButtonReleaseWithinBounds.webp
/usr/share/doc/qt6/qtquick/images/tapHandlerButtonWithinBounds.webp
/usr/share/doc/qt6/qtquick/images/tapHandlerOverlappingButtons.webp
/usr/share/doc/qt6/qtquick/images/touchpoint-metrics.png
/usr/share/doc/qt6/qtquick/images/touchpoints-pinchhandler.png
/usr/share/doc/qt6/qtquick/images/translate.png
/usr/share/doc/qt6/qtquick/images/twotextureproviders-example.jpg
/usr/share/doc/qt6/qtquick/images/verticalpositioner_example.png
/usr/share/doc/qt6/qtquick/images/verticalpositioner_transition.gif
/usr/share/doc/qt6/qtquick/images/viewtransitions-basic.gif
/usr/share/doc/qt6/qtquick/images/viewtransitions-delayedbyindex.gif
/usr/share/doc/qt6/qtquick/images/viewtransitions-intermediatemove.gif
/usr/share/doc/qt6/qtquick/images/viewtransitions-interruptedbad.gif
/usr/share/doc/qt6/qtquick/images/viewtransitions-interruptedgood.gif
/usr/share/doc/qt6/qtquick/images/viewtransitions-pathanim.gif
/usr/share/doc/qt6/qtquick/images/viewtransitions-scriptactionbad.gif
/usr/share/doc/qt6/qtquick/images/visual-coordinates-example.png
/usr/share/doc/qt6/qtquick/images/visual-parent-example.png
/usr/share/doc/qt6/qtquick/images/visual-parent-example2.png
/usr/share/doc/qt6/qtquick/images/visualcanvas_list.png
/usr/share/doc/qt6/qtquick/images/visualcanvas_overlap.png
/usr/share/doc/qt6/qtquick/images/visualize-batches.png
/usr/share/doc/qt6/qtquick/images/visualize-clip.png
/usr/share/doc/qt6/qtquick/images/visualize-original.png
/usr/share/doc/qt6/qtquick/images/visualize-overdraw-1.png
/usr/share/doc/qt6/qtquick/images/visualize-overdraw-2.png
/usr/share/doc/qt6/qtquick/images/visualpath-code-example.png
/usr/share/doc/qt6/qtquick/images/vulkantextureimport-example.jpg
/usr/share/doc/qt6/qtquick/images/vulkanunderqml-example.jpg
/usr/share/doc/qt6/qtquick/qml-advtutorial.html
/usr/share/doc/qt6/qtquick/qml-color.html
/usr/share/doc/qt6/qtquick/qml-dynamicview-tutorial.html
/usr/share/doc/qt6/qtquick/qml-font.html
/usr/share/doc/qt6/qtquick/qml-matrix4x4.html
/usr/share/doc/qt6/qtquick/qml-qt-labs-animation-boundaryrule-members.html
/usr/share/doc/qt6/qtquick/qml-qt-labs-animation-boundaryrule.html
/usr/share/doc/qt6/qtquick/qml-qt-labs-folderlistmodel-folderlistmodel-members.html
/usr/share/doc/qt6/qtquick/qml-qt-labs-folderlistmodel-folderlistmodel.html
/usr/share/doc/qt6/qtquick/qml-qt-labs-settings-settings-members.html
/usr/share/doc/qt6/qtquick/qml-qt-labs-settings-settings.html
/usr/share/doc/qt6/qtquick/qml-qt-labs-wavefrontmesh-wavefrontmesh-members.html
/usr/share/doc/qt6/qtquick/qml-qt-labs-wavefrontmesh-wavefrontmesh.html
/usr/share/doc/qt6/qtquick/qml-qtquick-accessible-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-accessible.html
/usr/share/doc/qt6/qtquick/qml-qtquick-anchoranimation-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-anchoranimation.html
/usr/share/doc/qt6/qtquick/qml-qtquick-anchorchanges-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-anchorchanges.html
/usr/share/doc/qt6/qtquick/qml-qtquick-animatedimage-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-animatedimage.html
/usr/share/doc/qt6/qtquick/qml-qtquick-animatedsprite-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-animatedsprite.html
/usr/share/doc/qt6/qtquick/qml-qtquick-animation-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-animation.html
/usr/share/doc/qt6/qtquick/qml-qtquick-animationcontroller-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-animationcontroller.html
/usr/share/doc/qt6/qtquick/qml-qtquick-animator-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-animator.html
/usr/share/doc/qt6/qtquick/qml-qtquick-application-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-application-obsolete.html
/usr/share/doc/qt6/qtquick/qml-qtquick-application.html
/usr/share/doc/qt6/qtquick/qml-qtquick-behavior-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-behavior.html
/usr/share/doc/qt6/qtquick/qml-qtquick-borderimage-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-borderimage.html
/usr/share/doc/qt6/qtquick/qml-qtquick-borderimagemesh-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-borderimagemesh.html
/usr/share/doc/qt6/qtquick/qml-qtquick-canvas-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-canvas-obsolete.html
/usr/share/doc/qt6/qtquick/qml-qtquick-canvas.html
/usr/share/doc/qt6/qtquick/qml-qtquick-canvasgradient-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-canvasgradient.html
/usr/share/doc/qt6/qtquick/qml-qtquick-canvasimagedata-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-canvasimagedata.html
/usr/share/doc/qt6/qtquick/qml-qtquick-canvaspixelarray-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-canvaspixelarray.html
/usr/share/doc/qt6/qtquick/qml-qtquick-closeevent-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-closeevent.html
/usr/share/doc/qt6/qtquick/qml-qtquick-coloranimation-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-coloranimation.html
/usr/share/doc/qt6/qtquick/qml-qtquick-colorgroup-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-colorgroup.html
/usr/share/doc/qt6/qtquick/qml-qtquick-column-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-column.html
/usr/share/doc/qt6/qtquick/qml-qtquick-context2d-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-context2d.html
/usr/share/doc/qt6/qtquick/qml-qtquick-doublevalidator-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-doublevalidator.html
/usr/share/doc/qt6/qtquick/qml-qtquick-drag-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-drag.html
/usr/share/doc/qt6/qtquick/qml-qtquick-dragevent-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-dragevent.html
/usr/share/doc/qt6/qtquick/qml-qtquick-draghandler-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-draghandler-obsolete.html
/usr/share/doc/qt6/qtquick/qml-qtquick-draghandler.html
/usr/share/doc/qt6/qtquick/qml-qtquick-droparea-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-droparea.html
/usr/share/doc/qt6/qtquick/qml-qtquick-effects-multieffect-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-effects-multieffect.html
/usr/share/doc/qt6/qtquick/qml-qtquick-enterkey-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-enterkey.html
/usr/share/doc/qt6/qtquick/qml-qtquick-eventpoint-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-eventpoint.html
/usr/share/doc/qt6/qtquick/qml-qtquick-flickable-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-flickable.html
/usr/share/doc/qt6/qtquick/qml-qtquick-flipable-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-flipable.html
/usr/share/doc/qt6/qtquick/qml-qtquick-flow-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-flow.html
/usr/share/doc/qt6/qtquick/qml-qtquick-focusscope-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-focusscope.html
/usr/share/doc/qt6/qtquick/qml-qtquick-fontloader-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-fontloader.html
/usr/share/doc/qt6/qtquick/qml-qtquick-fontmetrics-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-fontmetrics.html
/usr/share/doc/qt6/qtquick/qml-qtquick-frameanimation-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-frameanimation.html
/usr/share/doc/qt6/qtquick/qml-qtquick-gestureevent-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-gestureevent.html
/usr/share/doc/qt6/qtquick/qml-qtquick-gradient-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-gradient.html
/usr/share/doc/qt6/qtquick/qml-qtquick-gradientstop-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-gradientstop.html
/usr/share/doc/qt6/qtquick/qml-qtquick-graphicsinfo-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-graphicsinfo.html
/usr/share/doc/qt6/qtquick/qml-qtquick-grid-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-grid.html
/usr/share/doc/qt6/qtquick/qml-qtquick-gridmesh-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-gridmesh.html
/usr/share/doc/qt6/qtquick/qml-qtquick-gridview-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-gridview.html
/usr/share/doc/qt6/qtquick/qml-qtquick-handlerpoint-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-handlerpoint.html
/usr/share/doc/qt6/qtquick/qml-qtquick-hoverhandler-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-hoverhandler.html
/usr/share/doc/qt6/qtquick/qml-qtquick-image-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-image.html
/usr/share/doc/qt6/qtquick/qml-qtquick-inputmethod-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-inputmethod.html
/usr/share/doc/qt6/qtquick/qml-qtquick-intvalidator-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-intvalidator.html
/usr/share/doc/qt6/qtquick/qml-qtquick-item-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-item.html
/usr/share/doc/qt6/qtquick/qml-qtquick-itemgrabresult-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-itemgrabresult.html
/usr/share/doc/qt6/qtquick/qml-qtquick-keyevent-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-keyevent.html
/usr/share/doc/qt6/qtquick/qml-qtquick-keynavigation-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-keynavigation.html
/usr/share/doc/qt6/qtquick/qml-qtquick-keys-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-keys.html
/usr/share/doc/qt6/qtquick/qml-qtquick-layoutmirroring-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-layoutmirroring.html
/usr/share/doc/qt6/qtquick/qml-qtquick-layouts-columnlayout-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-layouts-columnlayout.html
/usr/share/doc/qt6/qtquick/qml-qtquick-layouts-gridlayout-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-layouts-gridlayout.html
/usr/share/doc/qt6/qtquick/qml-qtquick-layouts-layout-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-layouts-layout.html
/usr/share/doc/qt6/qtquick/qml-qtquick-layouts-layoutitemproxy-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-layouts-layoutitemproxy.html
/usr/share/doc/qt6/qtquick/qml-qtquick-layouts-rowlayout-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-layouts-rowlayout.html
/usr/share/doc/qt6/qtquick/qml-qtquick-layouts-stacklayout-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-layouts-stacklayout.html
/usr/share/doc/qt6/qtquick/qml-qtquick-listview-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-listview.html
/usr/share/doc/qt6/qtquick/qml-qtquick-loader-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-loader.html
/usr/share/doc/qt6/qtquick/qml-qtquick-matrix4x4-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-matrix4x4.html
/usr/share/doc/qt6/qtquick/qml-qtquick-mousearea-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-mousearea.html
/usr/share/doc/qt6/qtquick/qml-qtquick-mouseevent-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-mouseevent-obsolete.html
/usr/share/doc/qt6/qtquick/qml-qtquick-mouseevent.html
/usr/share/doc/qt6/qtquick/qml-qtquick-multipointhandler-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-multipointhandler.html
/usr/share/doc/qt6/qtquick/qml-qtquick-multipointtoucharea-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-multipointtoucharea.html
/usr/share/doc/qt6/qtquick/qml-qtquick-numberanimation-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-numberanimation.html
/usr/share/doc/qt6/qtquick/qml-qtquick-opacityanimator-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-opacityanimator.html
/usr/share/doc/qt6/qtquick/qml-qtquick-palette-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-palette.html
/usr/share/doc/qt6/qtquick/qml-qtquick-parallelanimation-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-parallelanimation.html
/usr/share/doc/qt6/qtquick/qml-qtquick-parentanimation-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-parentanimation.html
/usr/share/doc/qt6/qtquick/qml-qtquick-parentchange-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-parentchange.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-affector-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-affector.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-age-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-age.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-angledirection-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-angledirection.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-attractor-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-attractor.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-cumulativedirection-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-cumulativedirection.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-direction-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-direction.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-ellipseshape-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-ellipseshape.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-emitter-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-emitter.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-friction-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-friction.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-gravity-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-gravity-obsolete.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-gravity.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-groupgoal-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-groupgoal.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-imageparticle-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-imageparticle.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-itemparticle-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-itemparticle.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-lineshape-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-lineshape.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-maskshape-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-maskshape.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-particle-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-particle.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-particleextruder-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-particleextruder.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-particlegroup-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-particlegroup.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-particlepainter-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-particlepainter.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-particlesystem-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-particlesystem.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-pointdirection-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-pointdirection.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-rectangleshape-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-rectangleshape.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-spritegoal-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-spritegoal.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-targetdirection-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-targetdirection.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-trailemitter-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-trailemitter.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-turbulence-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-turbulence.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-wander-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-particles-wander.html
/usr/share/doc/qt6/qtquick/qml-qtquick-path-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-path.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathanglearc-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathanglearc.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathanimation-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathanimation.html
/usr/share/doc/qt6/qtquick/qml-qtquick-patharc-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-patharc.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathattribute-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathattribute.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathcubic-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathcubic.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathcurve-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathcurve.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathelement-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathelement.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathinterpolator-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathinterpolator.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathline-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathline.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathmove-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathmove.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathmultiline-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathmultiline.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathpercent-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathpercent.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathpolyline-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathpolyline.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathquad-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathquad.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathsvg-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathsvg.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathtext-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathtext.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathview-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pathview.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pauseanimation-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pauseanimation.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pincharea-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pincharea.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pinchevent-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pinchevent.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pinchhandler-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pinchhandler-obsolete.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pinchhandler.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pointerdevice-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pointerdevice.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pointerdevicehandler-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pointerdevicehandler.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pointerevent-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pointerevent.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pointerhandler-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pointerhandler.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pointhandler-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pointhandler.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pointingdeviceuniqueid-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-pointingdeviceuniqueid.html
/usr/share/doc/qt6/qtquick/qml-qtquick-positioner-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-positioner.html
/usr/share/doc/qt6/qtquick/qml-qtquick-propertyaction-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-propertyaction.html
/usr/share/doc/qt6/qtquick/qml-qtquick-propertyanimation-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-propertyanimation.html
/usr/share/doc/qt6/qtquick/qml-qtquick-propertychanges-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-propertychanges.html
/usr/share/doc/qt6/qtquick/qml-qtquick-rectangle-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-rectangle.html
/usr/share/doc/qt6/qtquick/qml-qtquick-regularexpressionvalidator-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-regularexpressionvalidator.html
/usr/share/doc/qt6/qtquick/qml-qtquick-repeater-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-repeater.html
/usr/share/doc/qt6/qtquick/qml-qtquick-rotation-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-rotation.html
/usr/share/doc/qt6/qtquick/qml-qtquick-rotationanimation-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-rotationanimation.html
/usr/share/doc/qt6/qtquick/qml-qtquick-rotationanimator-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-rotationanimator.html
/usr/share/doc/qt6/qtquick/qml-qtquick-row-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-row.html
/usr/share/doc/qt6/qtquick/qml-qtquick-scale-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-scale.html
/usr/share/doc/qt6/qtquick/qml-qtquick-scaleanimator-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-scaleanimator.html
/usr/share/doc/qt6/qtquick/qml-qtquick-screen-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-screen-obsolete.html
/usr/share/doc/qt6/qtquick/qml-qtquick-screen.html
/usr/share/doc/qt6/qtquick/qml-qtquick-scriptaction-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-scriptaction.html
/usr/share/doc/qt6/qtquick/qml-qtquick-sequentialanimation-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-sequentialanimation.html
/usr/share/doc/qt6/qtquick/qml-qtquick-shadereffect-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-shadereffect.html
/usr/share/doc/qt6/qtquick/qml-qtquick-shadereffectsource-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-shadereffectsource.html
/usr/share/doc/qt6/qtquick/qml-qtquick-shapes-conicalgradient-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-shapes-conicalgradient.html
/usr/share/doc/qt6/qtquick/qml-qtquick-shapes-lineargradient-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-shapes-lineargradient.html
/usr/share/doc/qt6/qtquick/qml-qtquick-shapes-radialgradient-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-shapes-radialgradient.html
/usr/share/doc/qt6/qtquick/qml-qtquick-shapes-shape-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-shapes-shape.html
/usr/share/doc/qt6/qtquick/qml-qtquick-shapes-shapegradient-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-shapes-shapegradient.html
/usr/share/doc/qt6/qtquick/qml-qtquick-shapes-shapepath-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-shapes-shapepath.html
/usr/share/doc/qt6/qtquick/qml-qtquick-shortcut-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-shortcut.html
/usr/share/doc/qt6/qtquick/qml-qtquick-singlepointhandler-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-singlepointhandler.html
/usr/share/doc/qt6/qtquick/qml-qtquick-smoothedanimation-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-smoothedanimation.html
/usr/share/doc/qt6/qtquick/qml-qtquick-springanimation-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-springanimation.html
/usr/share/doc/qt6/qtquick/qml-qtquick-sprite-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-sprite.html
/usr/share/doc/qt6/qtquick/qml-qtquick-spritesequence-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-spritesequence.html
/usr/share/doc/qt6/qtquick/qml-qtquick-state-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-state.html
/usr/share/doc/qt6/qtquick/qml-qtquick-statechangescript-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-statechangescript.html
/usr/share/doc/qt6/qtquick/qml-qtquick-stategroup-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-stategroup.html
/usr/share/doc/qt6/qtquick/qml-qtquick-systempalette-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-systempalette.html
/usr/share/doc/qt6/qtquick/qml-qtquick-tableview-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-tableview-obsolete.html
/usr/share/doc/qt6/qtquick/qml-qtquick-tableview.html
/usr/share/doc/qt6/qtquick/qml-qtquick-taphandler-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-taphandler.html
/usr/share/doc/qt6/qtquick/qml-qtquick-text-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-text-obsolete.html
/usr/share/doc/qt6/qtquick/qml-qtquick-text.html
/usr/share/doc/qt6/qtquick/qml-qtquick-textedit-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-textedit.html
/usr/share/doc/qt6/qtquick/qml-qtquick-textinput-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-textinput.html
/usr/share/doc/qt6/qtquick/qml-qtquick-textmetrics-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-textmetrics.html
/usr/share/doc/qt6/qtquick/qml-qtquick-touchpoint-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-touchpoint-obsolete.html
/usr/share/doc/qt6/qtquick/qml-qtquick-touchpoint.html
/usr/share/doc/qt6/qtquick/qml-qtquick-transform-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-transform.html
/usr/share/doc/qt6/qtquick/qml-qtquick-transition-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-transition.html
/usr/share/doc/qt6/qtquick/qml-qtquick-translate-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-translate.html
/usr/share/doc/qt6/qtquick/qml-qtquick-treeview-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-treeview.html
/usr/share/doc/qt6/qtquick/qml-qtquick-uniformanimator-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-uniformanimator.html
/usr/share/doc/qt6/qtquick/qml-qtquick-vector3danimation-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-vector3danimation.html
/usr/share/doc/qt6/qtquick/qml-qtquick-viewtransition-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-viewtransition.html
/usr/share/doc/qt6/qtquick/qml-qtquick-wheelevent-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-wheelevent.html
/usr/share/doc/qt6/qtquick/qml-qtquick-wheelhandler-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-wheelhandler.html
/usr/share/doc/qt6/qtquick/qml-qtquick-window-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-window.html
/usr/share/doc/qt6/qtquick/qml-qtquick-xanimator-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-xanimator.html
/usr/share/doc/qt6/qtquick/qml-qtquick-yanimator-members.html
/usr/share/doc/qt6/qtquick/qml-qtquick-yanimator.html
/usr/share/doc/qt6/qtquick/qml-quaternion.html
/usr/share/doc/qt6/qtquick/qml-tutorial.html
/usr/share/doc/qt6/qtquick/qml-tutorial1.html
/usr/share/doc/qt6/qtquick/qml-tutorial2.html
/usr/share/doc/qt6/qtquick/qml-tutorial3.html
/usr/share/doc/qt6/qtquick/qml-vector2d.html
/usr/share/doc/qt6/qtquick/qml-vector3d.html
/usr/share/doc/qt6/qtquick/qml-vector4d.html
/usr/share/doc/qt6/qtquick/qnativeinterface-qsgd3d11texture-members.html
/usr/share/doc/qt6/qtquick/qnativeinterface-qsgd3d11texture.html
/usr/share/doc/qt6/qtquick/qnativeinterface-qsgd3d12texture-members.html
/usr/share/doc/qt6/qtquick/qnativeinterface-qsgd3d12texture.html
/usr/share/doc/qt6/qtquick/qnativeinterface-qsgmetaltexture-members.html
/usr/share/doc/qt6/qtquick/qnativeinterface-qsgmetaltexture.html
/usr/share/doc/qt6/qtquick/qnativeinterface-qsgopengltexture-members.html
/usr/share/doc/qt6/qtquick/qnativeinterface-qsgopengltexture.html
/usr/share/doc/qt6/qtquick/qnativeinterface-qsgvulkantexture-members.html
/usr/share/doc/qt6/qtquick/qnativeinterface-qsgvulkantexture.html
/usr/share/doc/qt6/qtquick/qnativeinterface-sub-qtquick.html
/usr/share/doc/qt6/qtquick/qquickasyncimageprovider-members.html
/usr/share/doc/qt6/qtquick/qquickasyncimageprovider.html
/usr/share/doc/qt6/qtquick/qquickframebufferobject-members.html
/usr/share/doc/qt6/qtquick/qquickframebufferobject-renderer-members.html
/usr/share/doc/qt6/qtquick/qquickframebufferobject-renderer.html
/usr/share/doc/qt6/qtquick/qquickframebufferobject.html
/usr/share/doc/qt6/qtquick/qquickgraphicsconfiguration-members.html
/usr/share/doc/qt6/qtquick/qquickgraphicsconfiguration.html
/usr/share/doc/qt6/qtquick/qquickgraphicsdevice-members.html
/usr/share/doc/qt6/qtquick/qquickgraphicsdevice.html
/usr/share/doc/qt6/qtquick/qquickimageprovider-members.html
/usr/share/doc/qt6/qtquick/qquickimageprovider.html
/usr/share/doc/qt6/qtquick/qquickimageresponse-members.html
/usr/share/doc/qt6/qtquick/qquickimageresponse.html
/usr/share/doc/qt6/qtquick/qquickitem-itemchangedata-members.html
/usr/share/doc/qt6/qtquick/qquickitem-itemchangedata.html
/usr/share/doc/qt6/qtquick/qquickitem-members.html
/usr/share/doc/qt6/qtquick/qquickitem-obsolete.html
/usr/share/doc/qt6/qtquick/qquickitem.html
/usr/share/doc/qt6/qtquick/qquickitemgrabresult-members.html
/usr/share/doc/qt6/qtquick/qquickitemgrabresult.html
/usr/share/doc/qt6/qtquick/qquickopenglutils.html
/usr/share/doc/qt6/qtquick/qquickpainteditem-members.html
/usr/share/doc/qt6/qtquick/qquickpainteditem-obsolete.html
/usr/share/doc/qt6/qtquick/qquickpainteditem.html
/usr/share/doc/qt6/qtquick/qquickrendercontrol-members.html
/usr/share/doc/qt6/qtquick/qquickrendercontrol.html
/usr/share/doc/qt6/qtquick/qquickrendertarget-members.html
/usr/share/doc/qt6/qtquick/qquickrendertarget.html
/usr/share/doc/qt6/qtquick/qquicktextdocument-members.html
/usr/share/doc/qt6/qtquick/qquicktextdocument.html
/usr/share/doc/qt6/qtquick/qquicktexturefactory-members.html
/usr/share/doc/qt6/qtquick/qquicktexturefactory.html
/usr/share/doc/qt6/qtquick/qquickview-members.html
/usr/share/doc/qt6/qtquick/qquickview.html
/usr/share/doc/qt6/qtquick/qquickwidget-members.html
/usr/share/doc/qt6/qtquick/qquickwidget.html
/usr/share/doc/qt6/qtquick/qquickwindow-graphicsstateinfo-members.html
/usr/share/doc/qt6/qtquick/qquickwindow-graphicsstateinfo.html
/usr/share/doc/qt6/qtquick/qquickwindow-members.html
/usr/share/doc/qt6/qtquick/qquickwindow-obsolete.html
/usr/share/doc/qt6/qtquick/qquickwindow.html
/usr/share/doc/qt6/qtquick/qsgbasicgeometrynode-members.html
/usr/share/doc/qt6/qtquick/qsgbasicgeometrynode.html
/usr/share/doc/qt6/qtquick/qsgclipnode-members.html
/usr/share/doc/qt6/qtquick/qsgclipnode.html
/usr/share/doc/qt6/qtquick/qsgdynamictexture-members.html
/usr/share/doc/qt6/qtquick/qsgdynamictexture.html
/usr/share/doc/qt6/qtquick/qsgflatcolormaterial-members.html
/usr/share/doc/qt6/qtquick/qsgflatcolormaterial.html
/usr/share/doc/qt6/qtquick/qsggeometry-attribute-members.html
/usr/share/doc/qt6/qtquick/qsggeometry-attribute.html
/usr/share/doc/qt6/qtquick/qsggeometry-attributeset.html
/usr/share/doc/qt6/qtquick/qsggeometry-coloredpoint2d-members.html
/usr/share/doc/qt6/qtquick/qsggeometry-coloredpoint2d.html
/usr/share/doc/qt6/qtquick/qsggeometry-members.html
/usr/share/doc/qt6/qtquick/qsggeometry-point2d-members.html
/usr/share/doc/qt6/qtquick/qsggeometry-point2d.html
/usr/share/doc/qt6/qtquick/qsggeometry-texturedpoint2d-members.html
/usr/share/doc/qt6/qtquick/qsggeometry-texturedpoint2d.html
/usr/share/doc/qt6/qtquick/qsggeometry.html
/usr/share/doc/qt6/qtquick/qsggeometrynode-members.html
/usr/share/doc/qt6/qtquick/qsggeometrynode.html
/usr/share/doc/qt6/qtquick/qsgimagenode-members.html
/usr/share/doc/qt6/qtquick/qsgimagenode.html
/usr/share/doc/qt6/qtquick/qsgmaterial-members.html
/usr/share/doc/qt6/qtquick/qsgmaterial.html
/usr/share/doc/qt6/qtquick/qsgmaterialshader-graphicspipelinestate-members.html
/usr/share/doc/qt6/qtquick/qsgmaterialshader-graphicspipelinestate.html
/usr/share/doc/qt6/qtquick/qsgmaterialshader-members.html
/usr/share/doc/qt6/qtquick/qsgmaterialshader-renderstate-members.html
/usr/share/doc/qt6/qtquick/qsgmaterialshader-renderstate.html
/usr/share/doc/qt6/qtquick/qsgmaterialshader.html
/usr/share/doc/qt6/qtquick/qsgmaterialtype.html
/usr/share/doc/qt6/qtquick/qsgnode-members.html
/usr/share/doc/qt6/qtquick/qsgnode.html
/usr/share/doc/qt6/qtquick/qsgopacitynode-members.html
/usr/share/doc/qt6/qtquick/qsgopacitynode.html
/usr/share/doc/qt6/qtquick/qsgopaquetexturematerial-members.html
/usr/share/doc/qt6/qtquick/qsgopaquetexturematerial.html
/usr/share/doc/qt6/qtquick/qsgrectanglenode-members.html
/usr/share/doc/qt6/qtquick/qsgrectanglenode.html
/usr/share/doc/qt6/qtquick/qsgrendererinterface-members.html
/usr/share/doc/qt6/qtquick/qsgrendererinterface.html
/usr/share/doc/qt6/qtquick/qsgrendernode-members.html
/usr/share/doc/qt6/qtquick/qsgrendernode.html
/usr/share/doc/qt6/qtquick/qsgsimplerectnode-members.html
/usr/share/doc/qt6/qtquick/qsgsimplerectnode.html
/usr/share/doc/qt6/qtquick/qsgsimpletexturenode-members.html
/usr/share/doc/qt6/qtquick/qsgsimpletexturenode.html
/usr/share/doc/qt6/qtquick/qsgtexture-members.html
/usr/share/doc/qt6/qtquick/qsgtexture.html
/usr/share/doc/qt6/qtquick/qsgtexturematerial-members.html
/usr/share/doc/qt6/qtquick/qsgtexturematerial.html
/usr/share/doc/qt6/qtquick/qsgtextureprovider-members.html
/usr/share/doc/qt6/qtquick/qsgtextureprovider.html
/usr/share/doc/qt6/qtquick/qsgtransformnode-members.html
/usr/share/doc/qt6/qtquick/qsgtransformnode.html
/usr/share/doc/qt6/qtquick/qsgvertexcolormaterial-members.html
/usr/share/doc/qt6/qtquick/qsgvertexcolormaterial.html
/usr/share/doc/qt6/qtquick/qt-labs-animation-qmlmodule.html
/usr/share/doc/qt6/qtquick/qt-labs-folderlistmodel-qmlmodule.html
/usr/share/doc/qt6/qtquick/qt-labs-settings-qmlmodule-obsolete.html
/usr/share/doc/qt6/qtquick/qt-labs-sharedimage-qmlmodule.html
/usr/share/doc/qt6/qtquick/qt-labs-wavefrontmesh-qmlmodule.html
/usr/share/doc/qt6/qtquick/qtquick-animation-example.html
/usr/share/doc/qt6/qtquick/qtquick-bestpractices.html
/usr/share/doc/qt6/qtquick/qtquick-canvas-example.html
/usr/share/doc/qt6/qtquick/qtquick-codesamples.html
/usr/share/doc/qt6/qtquick/qtquick-convenience-topic.html
/usr/share/doc/qt6/qtquick/qtquick-cppextensionpoints.html
/usr/share/doc/qt6/qtquick/qtquick-customitems-dialcontrol-example.html
/usr/share/doc/qt6/qtquick/qtquick-customitems-flipable-example.html
/usr/share/doc/qt6/qtquick/qtquick-customitems-painteditem-example.html
/usr/share/doc/qt6/qtquick/qtquick-draganddrop-example.html
/usr/share/doc/qt6/qtquick/qtquick-effects-particles.html
/usr/share/doc/qt6/qtquick/qtquick-effects-qmlmodule.html
/usr/share/doc/qt6/qtquick/qtquick-effects-sprites.html
/usr/share/doc/qt6/qtquick/qtquick-effects-topic.html
/usr/share/doc/qt6/qtquick/qtquick-effects-transformations.html
/usr/share/doc/qt6/qtquick/qtquick-embeddedinwidgets-example.html
/usr/share/doc/qt6/qtquick/qtquick-how-tos.html
/usr/share/doc/qt6/qtquick/qtquick-imageelements-example.html
/usr/share/doc/qt6/qtquick/qtquick-imageprovider-example.html
/usr/share/doc/qt6/qtquick/qtquick-imageresponseprovider-example.html
/usr/share/doc/qt6/qtquick/qtquick-index.html
/usr/share/doc/qt6/qtquick/qtquick-input-focus.html
/usr/share/doc/qt6/qtquick/qtquick-input-mouseevents.html
/usr/share/doc/qt6/qtquick/qtquick-input-textinput.html
/usr/share/doc/qt6/qtquick/qtquick-input-topic.html
/usr/share/doc/qt6/qtquick/qtquick-itemvariablerefreshrate-example.html
/usr/share/doc/qt6/qtquick/qtquick-keyinteraction-example.html
/usr/share/doc/qt6/qtquick/qtquick-layouts-example.html
/usr/share/doc/qt6/qtquick/qtquick-layouts-qmlmodule.html
/usr/share/doc/qt6/qtquick/qtquick-localstorage-example.html
/usr/share/doc/qt6/qtquick/qtquick-localstorage-qmlmodule.html
/usr/share/doc/qt6/qtquick/qtquick-models-abstractitemmodel-example.html
/usr/share/doc/qt6/qtquick/qtquick-models-objectlistmodel-example.html
/usr/share/doc/qt6/qtquick/qtquick-models-stringlistmodel-example.html
/usr/share/doc/qt6/qtquick/qtquick-modelviewsdata-cppmodels.html
/usr/share/doc/qt6/qtquick/qtquick-modelviewsdata-modelview.html
/usr/share/doc/qt6/qtquick/qtquick-modelviewsdata-topic.html
/usr/share/doc/qt6/qtquick/qtquick-module.html
/usr/share/doc/qt6/qtquick/qtquick-mousearea-example.html
/usr/share/doc/qt6/qtquick/qtquick-multieffect-itemswitcher-example.html
/usr/share/doc/qt6/qtquick/qtquick-multieffect-testbed-example.html
/usr/share/doc/qt6/qtquick/qtquick-particles-affectors-example.html
/usr/share/doc/qt6/qtquick/qtquick-particles-emitters-example.html
/usr/share/doc/qt6/qtquick/qtquick-particles-imageparticle-example.html
/usr/share/doc/qt6/qtquick/qtquick-particles-performance.html
/usr/share/doc/qt6/qtquick/qtquick-particles-qmlmodule.html
/usr/share/doc/qt6/qtquick/qtquick-particles-system-example.html
/usr/share/doc/qt6/qtquick/qtquick-pointerhandlers-example.html
/usr/share/doc/qt6/qtquick/qtquick-positioners-example.html
/usr/share/doc/qt6/qtquick/qtquick-positioning-anchors.html
/usr/share/doc/qt6/qtquick/qtquick-positioning-layouts.html
/usr/share/doc/qt6/qtquick/qtquick-positioning-righttoleft.html
/usr/share/doc/qt6/qtquick/qtquick-positioning-topic.html
/usr/share/doc/qt6/qtquick/qtquick-qmlmodule.html
/usr/share/doc/qt6/qtquick/qtquick-quick-accessibility-example.html
/usr/share/doc/qt6/qtquick/qtquick-quickwidgets-qquickwidgetversuswindow-opengl-example.html
/usr/share/doc/qt6/qtquick/qtquick-quickwidgets-quickwidget-example.html
/usr/share/doc/qt6/qtquick/qtquick-rendercontrol-rendercontrol-d3d11-example.html
/usr/share/doc/qt6/qtquick/qtquick-rendercontrol-rendercontrol-opengl-example.html
/usr/share/doc/qt6/qtquick/qtquick-responsivelayouts-example.html
/usr/share/doc/qt6/qtquick/qtquick-scenegraph-customgeometry-example.html
/usr/share/doc/qt6/qtquick/qtquick-scenegraph-custommaterial-example.html
/usr/share/doc/qt6/qtquick/qtquick-scenegraph-customrendernode-example.html
/usr/share/doc/qt6/qtquick/qtquick-scenegraph-d3d11underqml-example.html
/usr/share/doc/qt6/qtquick/qtquick-scenegraph-graph-example.html
/usr/share/doc/qt6/qtquick/qtquick-scenegraph-materials.html
/usr/share/doc/qt6/qtquick/qtquick-scenegraph-metaltextureimport-example.html
/usr/share/doc/qt6/qtquick/qtquick-scenegraph-metalunderqml-example.html
/usr/share/doc/qt6/qtquick/qtquick-scenegraph-nodes.html
/usr/share/doc/qt6/qtquick/qtquick-scenegraph-openglunderqml-example.html
/usr/share/doc/qt6/qtquick/qtquick-scenegraph-rhitextureitem-example.html
/usr/share/doc/qt6/qtquick/qtquick-scenegraph-rhiunderqml-example.html
/usr/share/doc/qt6/qtquick/qtquick-scenegraph-twotextureproviders-example.html
/usr/share/doc/qt6/qtquick/qtquick-scenegraph-vulkantextureimport-example.html
/usr/share/doc/qt6/qtquick/qtquick-scenegraph-vulkanunderqml-example.html
/usr/share/doc/qt6/qtquick/qtquick-shadereffects-example.html
/usr/share/doc/qt6/qtquick/qtquick-shapes-example.html
/usr/share/doc/qt6/qtquick/qtquick-shapes-qmlmodule.html
/usr/share/doc/qt6/qtquick/qtquick-statesanimations-animations.html
/usr/share/doc/qt6/qtquick/qtquick-statesanimations-behaviors.html
/usr/share/doc/qt6/qtquick/qtquick-statesanimations-states.html
/usr/share/doc/qt6/qtquick/qtquick-statesanimations-topic.html
/usr/share/doc/qt6/qtquick/qtquick-tableview-gameoflife-example.html
/usr/share/doc/qt6/qtquick/qtquick-tableview-pixelator-example.html
/usr/share/doc/qt6/qtquick/qtquick-text-example.html
/usr/share/doc/qt6/qtquick/qtquick-tool-qmllint.html
/usr/share/doc/qt6/qtquick/qtquick-tool-qmlls.html
/usr/share/doc/qt6/qtquick/qtquick-tools-and-utilities.html
/usr/share/doc/qt6/qtquick/qtquick-tutorials-dynamicview-dynamicview1-example.html
/usr/share/doc/qt6/qtquick/qtquick-tutorials-dynamicview-dynamicview2-example.html
/usr/share/doc/qt6/qtquick/qtquick-tutorials-dynamicview-dynamicview3-example.html
/usr/share/doc/qt6/qtquick/qtquick-tutorials-dynamicview-dynamicview4-example.html
/usr/share/doc/qt6/qtquick/qtquick-tutorials-samegame-samegame1-example.html
/usr/share/doc/qt6/qtquick/qtquick-tutorials-samegame-samegame2-example.html
/usr/share/doc/qt6/qtquick/qtquick-tutorials-samegame-samegame3-example.html
/usr/share/doc/qt6/qtquick/qtquick-tutorials-samegame-samegame4-example.html
/usr/share/doc/qt6/qtquick/qtquick-views-example.html
/usr/share/doc/qt6/qtquick/qtquick-visualcanvas-adaptations-openvg.html
/usr/share/doc/qt6/qtquick/qtquick-visualcanvas-adaptations-software.html
/usr/share/doc/qt6/qtquick/qtquick-visualcanvas-adaptations.html
/usr/share/doc/qt6/qtquick/qtquick-visualcanvas-coordinates.html
/usr/share/doc/qt6/qtquick/qtquick-visualcanvas-scenegraph-renderer.html
/usr/share/doc/qt6/qtquick/qtquick-visualcanvas-scenegraph.html
/usr/share/doc/qt6/qtquick/qtquick-visualcanvas-topic.html
/usr/share/doc/qt6/qtquick/qtquick-visualcanvas-visualparent.html
/usr/share/doc/qt6/qtquick/qtquick-visualtypes-topic.html
/usr/share/doc/qt6/qtquick/qtquick-window-example.html
/usr/share/doc/qt6/qtquick/qtquick.index
/usr/share/doc/qt6/qtquick/qtquick.qhp
/usr/share/doc/qt6/qtquick/qtquick.qhp.sha1
/usr/share/doc/qt6/qtquick/qtquickhandlers-index.html
/usr/share/doc/qt6/qtquick/qtquicklayouts-index.html
/usr/share/doc/qt6/qtquick/qtquicklayouts-overview.html
/usr/share/doc/qt6/qtquick/qtquickwidgets-index.html
/usr/share/doc/qt6/qtquick/qtquickwidgets-module.html
/usr/share/doc/qt6/qtquick/quick-changes-qt6.html
/usr/share/doc/qt6/qtquick/style
/usr/share/doc/qt6/qtquick/style/offline-dark.css
/usr/share/doc/qt6/qtquick/style/offline-simple.css
/usr/share/doc/qt6/qtquick/style/offline.css
/usr/share/doc/qt6/qtquick3d/examples-manifest.xml
/usr/share/doc/qt6/qtquick3d/images
/usr/share/doc/qt6/qtquick3d/images/AA-GeometryAliasing.png
/usr/share/doc/qt6/qtquick3d/images/AA-ReflectionAliasing.png
/usr/share/doc/qt6/qtquick3d/images/AA-TextureAliasing.png
/usr/share/doc/qt6/qtquick3d/images/IBL-sphere-metallic-rough-directional-light.png
/usr/share/doc/qt6/qtquick3d/images/IBL-sphere-metallic-rough-environment-light.png
/usr/share/doc/qt6/qtquick3d/images/IBL-sphere-metallic-smooth-directional-light.png
/usr/share/doc/qt6/qtquick3d/images/IBL-sphere-metallic-smooth-environment-light-exposure.png
/usr/share/doc/qt6/qtquick3d/images/IBL-sphere-metallic-smooth-environment-light-horizon.png
/usr/share/doc/qt6/qtquick3d/images/IBL-sphere-metallic-smooth-environment-light-orientation.png
/usr/share/doc/qt6/qtquick3d/images/IBL-sphere-metallic-smooth-environment-light.png
/usr/share/doc/qt6/qtquick3d/images/IBL-sphere-rough-directional-light.png
/usr/share/doc/qt6/qtquick3d/images/IBL-sphere-rough-environment-light.png
/usr/share/doc/qt6/qtquick3d/images/IBL-sphere-smooth-directional-light.png
/usr/share/doc/qt6/qtquick3d/images/IBL-sphere-smooth-environment-light-exposure.png
/usr/share/doc/qt6/qtquick3d/images/IBL-sphere-smooth-environment-light-horizon.png
/usr/share/doc/qt6/qtquick3d/images/IBL-sphere-smooth-environment-light-orientation.png
/usr/share/doc/qt6/qtquick3d/images/IBL-sphere-smooth-environment-light.png
/usr/share/doc/qt6/qtquick3d/images/MaterialEditor-export.png
/usr/share/doc/qt6/qtquick3d/images/MaterialEditor-main.png
/usr/share/doc/qt6/qtquick3d/images/MaterialEditor-output.png
/usr/share/doc/qt6/qtquick3d/images/MaterialEditor-preview.jpg
/usr/share/doc/qt6/qtquick3d/images/MaterialEditor-properties.png
/usr/share/doc/qt6/qtquick3d/images/MaterialEditor-uniforms.png
/usr/share/doc/qt6/qtquick3d/images/MaterialEditor-vertex.png
/usr/share/doc/qt6/qtquick3d/images/VirtualAssistantHome.png
/usr/share/doc/qt6/qtquick3d/images/aa_disabled.jpg
/usr/share/doc/qt6/qtquick3d/images/aa_fxaa.jpg
/usr/share/doc/qt6/qtquick3d/images/aa_msaa_high.jpg
/usr/share/doc/qt6/qtquick3d/images/aa_ssaa_high.jpg
/usr/share/doc/qt6/qtquick3d/images/aa_temporal_default.jpg
/usr/share/doc/qt6/qtquick3d/images/antialiasing-example.png
/usr/share/doc/qt6/qtquick3d/images/arrow_bc.png
/usr/share/doc/qt6/qtquick3d/images/assetintro_balsamui_convert.jpg
/usr/share/doc/qt6/qtquick3d/images/assetintro_balsamui_open.jpg
/usr/share/doc/qt6/qtquick3d/images/assetintro_balsamui_options.jpg
/usr/share/doc/qt6/qtquick3d/images/assetintro_balsamui_startup.jpg
/usr/share/doc/qt6/qtquick3d/images/assetintro_empty.jpg
/usr/share/doc/qt6/qtquick3d/images/assetintro_sponza_dir.jpg
/usr/share/doc/qt6/qtquick3d/images/assetintro_sponza_first.jpg
/usr/share/doc/qt6/qtquick3d/images/assetintro_sponza_ibl.jpg
/usr/share/doc/qt6/qtquick3d/images/assetintro_sponza_ibl_2.jpg
/usr/share/doc/qt6/qtquick3d/images/assetintro_sponza_out.jpg
/usr/share/doc/qt6/qtquick3d/images/assetintro_sponza_second.jpg
/usr/share/doc/qt6/qtquick3d/images/assetintro_suzanne_cube.jpg
/usr/share/doc/qt6/qtquick3d/images/assetintro_suzanne_debugview.jpg
/usr/share/doc/qt6/qtquick3d/images/assetintro_suzanne_debugview_2.jpg
/usr/share/doc/qt6/qtquick3d/images/assetintro_suzanne_debugview_3.jpg
/usr/share/doc/qt6/qtquick3d/images/assetintro_suzanne_debugview_4.jpg
/usr/share/doc/qt6/qtquick3d/images/assetintro_suzanne_first.jpg
/usr/share/doc/qt6/qtquick3d/images/assetintro_suzanne_morelight.jpg
/usr/share/doc/qt6/qtquick3d/images/assetintro_suzanne_override.jpg
/usr/share/doc/qt6/qtquick3d/images/axishelper.jpg
/usr/share/doc/qt6/qtquick3d/images/bakedlightmap-example.jpg
/usr/share/doc/qt6/qtquick3d/images/bgrContent.png
/usr/share/doc/qt6/qtquick3d/images/blender.jpg
/usr/share/doc/qt6/qtquick3d/images/btn_next.png
/usr/share/doc/qt6/qtquick3d/images/btn_prev.png
/usr/share/doc/qt6/qtquick3d/images/bullet_dn.png
/usr/share/doc/qt6/qtquick3d/images/bullet_sq.png
/usr/share/doc/qt6/qtquick3d/images/customeffect-example.jpg
/usr/share/doc/qt6/qtquick3d/images/customgeometry-example.jpg
/usr/share/doc/qt6/qtquick3d/images/customgeometry.jpg
/usr/share/doc/qt6/qtquick3d/images/custominstancing.jpg
/usr/share/doc/qt6/qtquick3d/images/custommaterial-example.jpg
/usr/share/doc/qt6/qtquick3d/images/custommaterial_cylinder.png
/usr/share/doc/qt6/qtquick3d/images/custommorphing.png
/usr/share/doc/qt6/qtquick3d/images/customshaders-example.jpg
/usr/share/doc/qt6/qtquick3d/images/debugsettings_basecolor.jpg
/usr/share/doc/qt6/qtquick3d/images/debugsettings_default.jpg
/usr/share/doc/qt6/qtquick3d/images/debugsettings_diffuse.jpg
/usr/share/doc/qt6/qtquick3d/images/debugsettings_metalness.jpg
/usr/share/doc/qt6/qtquick3d/images/debugsettings_normals.jpg
/usr/share/doc/qt6/qtquick3d/images/debugsettings_roughness.jpg
/usr/share/doc/qt6/qtquick3d/images/debugsettings_specular.jpg
/usr/share/doc/qt6/qtquick3d/images/debugsettings_wireframe.jpg
/usr/share/doc/qt6/qtquick3d/images/directionallight-1.png
/usr/share/doc/qt6/qtquick3d/images/directionallight-2.png
/usr/share/doc/qt6/qtquick3d/images/dragon.jpg
/usr/share/doc/qt6/qtquick3d/images/dynamiccreation-example.png
/usr/share/doc/qt6/qtquick3d/images/effect_additive_color_gradient.png
/usr/share/doc/qt6/qtquick3d/images/effect_blur.png
/usr/share/doc/qt6/qtquick3d/images/effect_brush_strokes.png
/usr/share/doc/qt6/qtquick3d/images/effect_chromatic_aberration.png
/usr/share/doc/qt6/qtquick3d/images/effect_color_master.png
/usr/share/doc/qt6/qtquick3d/images/effect_depth_of_field_hq_blur.png
/usr/share/doc/qt6/qtquick3d/images/effect_desaturate.png
/usr/share/doc/qt6/qtquick3d/images/effect_distortion_ripple.png
/usr/share/doc/qt6/qtquick3d/images/effect_distortion_sphere.png
/usr/share/doc/qt6/qtquick3d/images/effect_distortion_spiral.png
/usr/share/doc/qt6/qtquick3d/images/effect_edge_detect.png
/usr/share/doc/qt6/qtquick3d/images/effect_emboss.png
/usr/share/doc/qt6/qtquick3d/images/effect_flip.png
/usr/share/doc/qt6/qtquick3d/images/effect_fxaa.png
/usr/share/doc/qt6/qtquick3d/images/effect_gaussian_blur.png
/usr/share/doc/qt6/qtquick3d/images/effect_hdr_bloom_tonemap.png
/usr/share/doc/qt6/qtquick3d/images/effect_intro_1.png
/usr/share/doc/qt6/qtquick3d/images/effect_intro_2.png
/usr/share/doc/qt6/qtquick3d/images/effect_intro_3.png
/usr/share/doc/qt6/qtquick3d/images/effect_motion_blur.png
/usr/share/doc/qt6/qtquick3d/images/effect_scatter.png
/usr/share/doc/qt6/qtquick3d/images/effect_scurve_graph.png
/usr/share/doc/qt6/qtquick3d/images/effect_scurve_tonemap.png
/usr/share/doc/qt6/qtquick3d/images/effect_tilt_shift.png
/usr/share/doc/qt6/qtquick3d/images/effect_vignette.png
/usr/share/doc/qt6/qtquick3d/images/export-blender-enable-fbx-addon.png
/usr/share/doc/qt6/qtquick3d/images/export-blender-fbx-axis.png
/usr/share/doc/qt6/qtquick3d/images/export-blender1.png
/usr/share/doc/qt6/qtquick3d/images/export-blender2.png
/usr/share/doc/qt6/qtquick3d/images/export-blender3.png
/usr/share/doc/qt6/qtquick3d/images/export-blender4.png
/usr/share/doc/qt6/qtquick3d/images/export-blender5.png
/usr/share/doc/qt6/qtquick3d/images/export-blender6.png
/usr/share/doc/qt6/qtquick3d/images/export-colladaMax01.png
/usr/share/doc/qt6/qtquick3d/images/export-colladaMax02.png
/usr/share/doc/qt6/qtquick3d/images/export-colladaMaya01.png
/usr/share/doc/qt6/qtquick3d/images/export-colladaMaya02.png
/usr/share/doc/qt6/qtquick3d/images/export-colladaMaya03.png
/usr/share/doc/qt6/qtquick3d/images/export-colladaMaya04.png
/usr/share/doc/qt6/qtquick3d/images/export-colladaModo01.png
/usr/share/doc/qt6/qtquick3d/images/export-colladaModo02.png
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_aa.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_brightness_at_4.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_brightness_contrast_saturation_at_1.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_coloradj.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_colorgrade.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_contrast_at_4.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_dof.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_dof_15_blur.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_dof_no_blur.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_fog.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_glow.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_glow_additive.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_glow_disabled.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_glow_intensity_025.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_glow_intensity_125.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_glow_level4_strength15_intensity1_bloom0.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_glow_level4_strength15_intensity1_bloom05.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_glow_levels_1.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_glow_levels_1_2.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_glow_levels_1_2_3.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_glow_levels_1_2_3_4.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_glow_replace.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_glow_screen.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_glow_softlight.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_glow_strength_05.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_glow_strength_15.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_lensflare.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_lensflare_0_blur.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_lensflare_30_blur.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_lensflare_bias_031.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_lensflare_bias_081.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_lensflare_default_dirt.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_lensflare_default_noise.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_lensflare_default_texture.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_lensflare_dirt_off.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_lensflare_dirt_on.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_lensflare_distortion_0.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_lensflare_distortion_15.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_lensflare_ghostcount_16.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_lensflare_ghostcount_2.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_lensflare_ghostdispersal_025.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_lensflare_ghostdispersal_090.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_lensflare_scale_20_bias_081.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_lensflare_scale_2_bias_081.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_lensflare_starburst_off.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_lensflare_starburst_on.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_lut_invert.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_lut_texture_used_for_invert.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_saturation_at_4.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_ssao.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_tonemap.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_tonemap_aces.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_tonemap_exposure_05.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_tonemap_exposure_8.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_tonemap_filmic.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_tonemap_hejldawson.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_tonemap_linear.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_tonemap_none.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_tonemap_sharpness_0.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_tonemap_sharpness_1.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_tonemap_whitepoint_01.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_tonemap_whitepoint_1.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_vignette.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_vignette_radius_5.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_vignette_radius_default.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_vignette_red.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_vignette_strength_10.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_vignette_strength_15.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_with_fxaa.jpg
/usr/share/doc/qt6/qtquick3d/images/extendedsceneenvironment_without_fxaa.jpg
/usr/share/doc/qt6/qtquick3d/images/fog.jpg
/usr/share/doc/qt6/qtquick3d/images/fog_color_1.jpg
/usr/share/doc/qt6/qtquick3d/images/fog_color_2.jpg
/usr/share/doc/qt6/qtquick3d/images/fog_density_015.jpg
/usr/share/doc/qt6/qtquick3d/images/fog_density_095.jpg
/usr/share/doc/qt6/qtquick3d/images/fog_depthnear_higher.jpg
/usr/share/doc/qt6/qtquick3d/images/fog_depthnear_lower.jpg
/usr/share/doc/qt6/qtquick3d/images/fog_height_least_y_bigger.jpg
/usr/share/doc/qt6/qtquick3d/images/fog_height_least_y_smaller.jpg
/usr/share/doc/qt6/qtquick3d/images/gridgeometry.jpg
/usr/share/doc/qt6/qtquick3d/images/hellocube.png
/usr/share/doc/qt6/qtquick3d/images/helloqtquick3d.jpg
/usr/share/doc/qt6/qtquick3d/images/home.png
/usr/share/doc/qt6/qtquick3d/images/ico_note.png
/usr/share/doc/qt6/qtquick3d/images/ico_note_attention.png
/usr/share/doc/qt6/qtquick3d/images/ico_out.png
/usr/share/doc/qt6/qtquick3d/images/instancing.jpg
/usr/share/doc/qt6/qtquick3d/images/intro.png
/usr/share/doc/qt6/qtquick3d/images/inverseBindPoses.png
/usr/share/doc/qt6/qtquick3d/images/inverseBindPoses2.png
/usr/share/doc/qt6/qtquick3d/images/jointinfo.png
/usr/share/doc/qt6/qtquick3d/images/jointinfo2.png
/usr/share/doc/qt6/qtquick3d/images/lightmap_noise_denoised.jpg
/usr/share/doc/qt6/qtquick3d/images/lightmap_noise_original.jpg
/usr/share/doc/qt6/qtquick3d/images/lightmap_simple_all.jpg
/usr/share/doc/qt6/qtquick3d/images/lightmap_simple_none.jpg
/usr/share/doc/qt6/qtquick3d/images/lightmap_sponza_indirect.jpg
/usr/share/doc/qt6/qtquick3d/images/lightmap_sponza_none.jpg
/usr/share/doc/qt6/qtquick3d/images/lights-example.jpg
/usr/share/doc/qt6/qtquick3d/images/lod_balsamui.png
/usr/share/doc/qt6/qtquick3d/images/lodhelper-example.jpg
/usr/share/doc/qt6/qtquick3d/images/lodmanager_diagram.png
/usr/share/doc/qt6/qtquick3d/images/logo.png
/usr/share/doc/qt6/qtquick3d/images/madewithqt.png
/usr/share/doc/qt6/qtquick3d/images/morphing.png
/usr/share/doc/qt6/qtquick3d/images/orthographiccamera.png
/usr/share/doc/qt6/qtquick3d/images/partialderivatives.png
/usr/share/doc/qt6/qtquick3d/images/particles3d-loggingview.jpg
/usr/share/doc/qt6/qtquick3d/images/particles3d-settings.jpg
/usr/share/doc/qt6/qtquick3d/images/particles3d-snowing.jpg
/usr/share/doc/qt6/qtquick3d/images/particles3d-testbed.jpg
/usr/share/doc/qt6/qtquick3d/images/pbr_example.jpg
/usr/share/doc/qt6/qtquick3d/images/perspectivecamera.png
/usr/share/doc/qt6/qtquick3d/images/picking-example.png
/usr/share/doc/qt6/qtquick3d/images/pointlight-1.png
/usr/share/doc/qt6/qtquick3d/images/pointlight-2.png
/usr/share/doc/qt6/qtquick3d/images/pointlight-3.png
/usr/share/doc/qt6/qtquick3d/images/principledmaterial-example.png
/usr/share/doc/qt6/qtquick3d/images/proceduraltexture-example.jpg
/usr/share/doc/qt6/qtquick3d/images/qtquick3d-postprocess-graph.drawio.svg
/usr/share/doc/qt6/qtquick3d/images/qtquick3d-rendergraph.drawio.svg
/usr/share/doc/qt6/qtquick3d/images/quick2d-3d-1.jpg
/usr/share/doc/qt6/qtquick3d/images/quick2d-3d-2.jpg
/usr/share/doc/qt6/qtquick3d/images/quick2d-3d-3.jpg
/usr/share/doc/qt6/qtquick3d/images/quick2d-3d-4.jpg
/usr/share/doc/qt6/qtquick3d/images/quick2d-3d-5.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-custmat-tex1-anim.gif
/usr/share/doc/qt6/qtquick3d/images/quick3d-custmat-tex2-anim.gif
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-blend.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-chained-effect-anim.gif
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-color1.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-color2.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-color3.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-cube1-small.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-cube1.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-cube2-anim.gif
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-cube3-anim.gif
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-cube4.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-cube5.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-cube6.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-cube7-anim.gif
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-cube8.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-cube9.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-depth-anim.gif
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-effect-section-scene.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-effect1.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-effect2.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-first-effect-anim.gif
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-geom.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-heightmap.png
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-mat1.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-mat2.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-normalmap.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-points.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-screen.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-tex.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-tex3.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-tex4.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-unshaded-anim.gif
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-unshaded1.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-varying-map.png
/usr/share/doc/qt6/qtquick3d/images/quick3d-custom-varying1.jpg
/usr/share/doc/qt6/qtquick3d/images/quick3d-graphics-stack.drawio.svg
/usr/share/doc/qt6/qtquick3d/images/quick3d-principled-qt5.png
/usr/share/doc/qt6/qtquick3d/images/quick3d-principled-qt6.png
/usr/share/doc/qt6/qtquick3d/images/quickball-ball.png
/usr/share/doc/qt6/qtquick3d/images/quickball-example.jpg
/usr/share/doc/qt6/qtquick3d/images/quickball-world.png
/usr/share/doc/qt6/qtquick3d/images/quickitems-example.png
/usr/share/doc/qt6/qtquick3d/images/reflectionprobes-example.jpg
/usr/share/doc/qt6/qtquick3d/images/runtimeloader-example.jpg
/usr/share/doc/qt6/qtquick3d/images/runtimeloader-normals.jpg
/usr/share/doc/qt6/qtquick3d/images/sceneeffects-example.jpg
/usr/share/doc/qt6/qtquick3d/images/sceneenvironment_ao_distance_1.jpg
/usr/share/doc/qt6/qtquick3d/images/sceneenvironment_ao_distance_5.jpg
/usr/share/doc/qt6/qtquick3d/images/sceneenvironment_ao_full_strength.jpg
/usr/share/doc/qt6/qtquick3d/images/sceneenvironment_ao_half_strength.jpg
/usr/share/doc/qt6/qtquick3d/images/sceneenvironment_ao_off.jpg
/usr/share/doc/qt6/qtquick3d/images/sceneenvironment_ao_softness_default.jpg
/usr/share/doc/qt6/qtquick3d/images/sceneenvironment_ao_softness_half.jpg
/usr/share/doc/qt6/qtquick3d/images/sceneenvironment_background_color.jpg
/usr/share/doc/qt6/qtquick3d/images/sceneenvironment_background_ibl.jpg
/usr/share/doc/qt6/qtquick3d/images/sceneenvironment_background_transparent.jpg
/usr/share/doc/qt6/qtquick3d/images/sceneenvironment_lightprobe.jpg
/usr/share/doc/qt6/qtquick3d/images/sceneenvironment_lightprobe_2.jpg
/usr/share/doc/qt6/qtquick3d/images/sceneenvironment_lightprobe_null.jpg
/usr/share/doc/qt6/qtquick3d/images/sceneenvironment_lightprobe_null_2.jpg
/usr/share/doc/qt6/qtquick3d/images/sceneenvironment_lightprobe_proceduralsky.jpg
/usr/share/doc/qt6/qtquick3d/images/sceneenvironment_lightprobe_transparent.jpg
/usr/share/doc/qt6/qtquick3d/images/sceneenvironment_lightprobe_transparent_2.jpg
/usr/share/doc/qt6/qtquick3d/images/screenspacereflections-example.jpg
/usr/share/doc/qt6/qtquick3d/images/simplefog.jpg
/usr/share/doc/qt6/qtquick3d/images/skinning.png
/usr/share/doc/qt6/qtquick3d/images/specular_aa_off.jpg
/usr/share/doc/qt6/qtquick3d/images/specular_aa_on.jpg
/usr/share/doc/qt6/qtquick3d/images/spheremap.png
/usr/share/doc/qt6/qtquick3d/images/spotlight-1.png
/usr/share/doc/qt6/qtquick3d/images/spotlight-2.png
/usr/share/doc/qt6/qtquick3d/images/submeshes-example.png
/usr/share/doc/qt6/qtquick3d/images/submeshes-example1.png
/usr/share/doc/qt6/qtquick3d/images/submeshes-example2.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/customeffect
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/customeffect/checkers2.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/customeffect/qt_logo_rect.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/customgeometry
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/customgeometry/qt_logo_rect.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/customshaders
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/customshaders/qt_logo.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/hellocube
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/hellocube/qt_logo.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/helloqtquick3d
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/helloqtquick3d/qt_logo.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/lights
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/lights/icon_settings.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/lights/icon_settings@2x.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/lights/icon_settings@3x.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/lights/icon_settings@4x.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/lodhelper
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/lodhelper/maps
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/lodhelper/maps/baseColor.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/lodhelper/maps/normal.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/lodhelper/maps/occlusionRoughnessMetallic.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/arrow_icon.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/bear_black.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/colorTable.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/color_table2.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/color_table3.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/color_table4.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/color_table5.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/dot.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/dust.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/explosion_01_strip13.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/icon_interval.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/icon_logging.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/icon_pause.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/icon_play.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/icon_settings.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/leather_n.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/qt_logo.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/qt_logo2.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/qt_logo2_n.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/smoke.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/smoke_sprite.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/snowflake.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/speedometer_labels.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/sphere.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/sprite_09.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/star.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/star2.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/particles3d/images/star3.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/picking
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/picking/maps
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/picking/maps/roughness.jpg
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/principledmaterial
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/principledmaterial/maps
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/principledmaterial/maps/alpha_gradient.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/principledmaterial/maps/curtain_normal.jpg
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/principledmaterial/maps/grid.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/principledmaterial/maps/metallic
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/principledmaterial/maps/metallic/basecolor.jpg
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/principledmaterial/maps/metallic/metallic.jpg
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/principledmaterial/maps/metallic/normal.jpg
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/principledmaterial/maps/metallic/roughness.jpg
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/principledmaterial/maps/monkey_ao.jpg
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/principledmaterial/maps/monkey_thickness.jpg
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/principledmaterial/maps/noise.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/principledmaterial/maps/normal_stamp.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/principledmaterial/maps/small_envmap.jpg
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/principledmaterial/maps/tilepattern.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/quickball
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/quickball/images
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/quickball/images/ball.jpg
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/quickball/images/ball_icon.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/quickball/images/ball_n.jpg
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/quickball/images/grass.jpg
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/quickball/images/grass_n.jpg
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/quickball/images/particle.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/quickball/images/qt_logo.jpg
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/quickball/images/qt_logo_n.jpg
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/quickball/images/quickball.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/quickball/images/sky.jpg
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/quickitems
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/quickitems/Built_with_Qt_RGB_logo_vertical.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/reflectionprobes
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/reflectionprobes/res
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/reflectionprobes/res/icon_settings.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/reflectionprobes/res/snowflake.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/sceneeffects
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/sceneeffects/images
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/sceneeffects/images/TreeExpanded.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/sceneeffects/images/TreeExpanded@2x.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/sceneeffects/images/TreeExpanded@3x.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/sceneeffects/images/TreeExpanded@4x.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/sceneeffects/images/TreeUnexpanded.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/sceneeffects/images/TreeUnexpanded@2x.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/sceneeffects/images/TreeUnexpanded@3x.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/sceneeffects/images/TreeUnexpanded@4x.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/sceneeffects/images/grid_8x8.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/sceneeffects/luts
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/sceneeffects/luts/grayscale.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/sceneeffects/luts/identity.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/sceneeffects/luts/inverted.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/screenspacereflections
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/screenspacereflections/qt_logo_rect.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/volumeraycaster
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/volumeraycaster/images
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/volumeraycaster/images/circle.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/volumeraycaster/images/colormap-coolwarm.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/volumeraycaster/images/colormap-gist_rainbow.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/volumeraycaster/images/colormap-gnuplot.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/volumeraycaster/images/colormap-plasma.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/volumeraycaster/images/colormap-rainbow.png
/usr/share/doc/qt6/qtquick3d/images/used-in-examples/volumeraycaster/images/colormap-viridis.png
/usr/share/doc/qt6/qtquick3d/images/vertexinfo.png
/usr/share/doc/qt6/qtquick3d/images/view3d-example.png
/usr/share/doc/qt6/qtquick3d/images/volumeraycaster.webp
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-assetutils-runtimeloader-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-assetutils-runtimeloader.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-bakedlightmap-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-bakedlightmap.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-bounds-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-bounds.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-buffer-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-buffer.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-bufferinput-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-bufferinput.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-camera-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-camera.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-command-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-command.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-cubemaptexture-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-cubemaptexture.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-customcamera-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-customcamera.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-custommaterial-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-custommaterial.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-debugsettings-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-debugsettings.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-defaultmaterial-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-defaultmaterial.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-directionallight-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-directionallight.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effect-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effect.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-additivecolorgradient-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-additivecolorgradient.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-blur-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-blur.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-brushstrokes-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-brushstrokes.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-chromaticaberration-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-chromaticaberration.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-colormaster-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-colormaster.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-depthoffieldhqblur-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-depthoffieldhqblur.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-desaturate-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-desaturate.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-distortionripple-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-distortionripple.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-distortionsphere-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-distortionsphere.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-distortionspiral-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-distortionspiral.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-edgedetect-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-edgedetect.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-emboss-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-emboss.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-flip-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-flip.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-fxaa-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-fxaa.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-gaussianblur-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-gaussianblur.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-hdrbloomtonemap-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-hdrbloomtonemap.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-motionblur-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-motionblur.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-scatter-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-scatter.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-scurvetonemap-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-scurvetonemap.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-tiltshift-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-tiltshift.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-vignette-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-effects-vignette.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-fileinstancing-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-fileinstancing.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-fog-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-fog.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-frustumcamera-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-frustumcamera.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-geometry-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-geometry.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-axishelper-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-axishelper.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-debugview-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-debugview.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-extendedsceneenvironment-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-extendedsceneenvironment.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-gridgeometry-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-gridgeometry.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-heightfieldgeometry-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-heightfieldgeometry-obsolete.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-heightfieldgeometry.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-infinitegrid-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-infinitegrid.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-instancemodel-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-instancemodel.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-instancerange-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-instancerange.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-instancerepeater-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-instancerepeater.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-lodmanager-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-lodmanager.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-lookatnode-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-lookatnode.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-orbitcameracontroller-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-orbitcameracontroller.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-proceduralskytexturedata-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-proceduralskytexturedata.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-randominstancing-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-randominstancing.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-wasdcontroller-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-helpers-wasdcontroller.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-instancelist-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-instancelist.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-instancelistentry-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-instancelistentry.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-instancing-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-instancing.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-joint-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-joint.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-light-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-light.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-lightmapper-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-lightmapper.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-loader3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-loader3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-material-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-material.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-model-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-model.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-morphtarget-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-morphtarget.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-node-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-node.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-object3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-object3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-orthographiccamera-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-orthographiccamera.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-affector3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-affector3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-attractor3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-attractor3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-direction3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-direction3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-dynamicburst3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-dynamicburst3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-emitburst3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-emitburst3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-gravity3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-gravity3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-lineparticle3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-lineparticle3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-modelblendparticle3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-modelblendparticle3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-modelparticle3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-modelparticle3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-particle3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-particle3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-particleabstractshape3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-particleabstractshape3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-particlecustomshape3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-particlecustomshape3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-particleemitter3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-particleemitter3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-particlemodelshape3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-particlemodelshape3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-particleshape3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-particleshape3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-particlesystem3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-particlesystem3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-particlesystem3dlogging-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-particlesystem3dlogging.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-pointrotator3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-pointrotator3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-repeller3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-repeller3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-scaleaffector3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-scaleaffector3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-spriteparticle3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-spriteparticle3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-spritesequence3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-spritesequence3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-targetdirection3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-targetdirection3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-trailemitter3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-trailemitter3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-vectordirection3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-vectordirection3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-wander3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-particles3d-wander3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-pass-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-pass.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-perspectivecamera-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-perspectivecamera.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-pickresult-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-pickresult.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-pointlight-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-pointlight.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-principledmaterial-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-principledmaterial.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-quaternion-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-quaternion.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-quaternionanimation-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-quaternionanimation.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-reflectionprobe-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-reflectionprobe.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-renderstats-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-renderstats.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-repeater3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-repeater3d.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-resourceloader-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-resourceloader.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-sceneenvironment-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-sceneenvironment.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-setuniformvalue-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-setuniformvalue.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-shader-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-shader.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-skeleton-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-skeleton.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-skin-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-skin.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-specularglossymaterial-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-specularglossymaterial.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-spotlight-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-spotlight.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-texture-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-texture.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-texturedata-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-texturedata.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-textureinput-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-textureinput.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-view3d-members.html
/usr/share/doc/qt6/qtquick3d/qml-qtquick3d-view3d.html
/usr/share/doc/qt6/qtquick3d/qquick3d-members.html
/usr/share/doc/qt6/qtquick3d/qquick3d.html
/usr/share/doc/qt6/qtquick3d/qquick3dextensionhelpers-members.html
/usr/share/doc/qt6/qtquick3d/qquick3dextensionhelpers.html
/usr/share/doc/qt6/qtquick3d/qquick3dgeometry-members.html
/usr/share/doc/qt6/qtquick3d/qquick3dgeometry.html
/usr/share/doc/qt6/qtquick3d/qquick3dinstancing-members.html
/usr/share/doc/qt6/qtquick3d/qquick3dinstancing.html
/usr/share/doc/qt6/qtquick3d/qquick3dobject-members.html
/usr/share/doc/qt6/qtquick3d/qquick3dobject.html
/usr/share/doc/qt6/qtquick3d/qquick3drenderextension-members.html
/usr/share/doc/qt6/qtquick3d/qquick3drenderextension.html
/usr/share/doc/qt6/qtquick3d/qquick3dtexturedata-members.html
/usr/share/doc/qt6/qtquick3d/qquick3dtexturedata.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-2d.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-antialiasing-antialiasing-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-antialiasing-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-antialiasing-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-antialiasing-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-antialiasing-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-antialiasing-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-architecture.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-assetutils-qmlmodule.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-attribution-alpha-blending-frag.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-attribution-assimp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-attribution-embree.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-attribution-fog.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-attribution-meshoptimizer.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-attribution-proceduralsky.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-attribution-tinyexr.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-attribution-xatlas.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-bakedlightmap-bakedlightmap-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-bakedlightmap-box-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-bakedlightmap-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-bakedlightmap-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-bakedlightmap-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-bakedlightmap-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-bakedlightmap-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-changes-qt6.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custom.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customeffect-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customeffect-customeffect-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customeffect-effect-frag.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customeffect-effect2-frag.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customeffect-effect2-vert.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customeffect-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customeffect-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customeffect-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customeffect-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customgeometry-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customgeometry-customgeometry-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customgeometry-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customgeometry-examplegeometry-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customgeometry-examplegeometry-h.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customgeometry-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customgeometry-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customgeometry-qmldir.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customgeometry-torusmesh-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custominstancing-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custominstancing-cppinstancetable-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custominstancing-cppinstancetable-h.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custominstancing-cubematerial-frag.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custominstancing-cubematerial-vert.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custominstancing-custominstancing-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custominstancing-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custominstancing-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custominstancing-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custominstancing-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custommaterial-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custommaterial-custommaterial-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custommaterial-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custommaterial-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custommaterial-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custommaterial-material-customlights-frag.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custommaterial-material-customspecular-frag.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custommaterial-material-distortion-vert.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custommaterial-material-metallic-frag.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custommaterial-material-simple-frag.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custommaterial-material-transparent-frag.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custommaterial-materials-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custommaterial-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custommaterial-screen-frag.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custommorphing-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custommorphing-custommorphing-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custommorphing-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custommorphing-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custommorphing-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custommorphing-morphgeometry-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custommorphing-morphgeometry-h.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-custommorphing-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customshaders-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customshaders-customshaders-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customshaders-example-frag.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customshaders-example-tex-frag.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customshaders-example-vert.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customshaders-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customshaders-examplematerial-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customshaders-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customshaders-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customshaders-materialcontrol-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-customshaders-resources-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-dynamiccreation-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-dynamiccreation-dynamiccreation-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-dynamiccreation-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-dynamiccreation-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-dynamiccreation-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-dynamiccreation-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-dynamiccreation-weirdshape-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-effects-qmlmodule-obsolete.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-hellocube-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-hellocube-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-hellocube-hellocube-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-hellocube-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-hellocube-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-hellocube-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-helloqtquick3d-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-helloqtquick3d-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-helloqtquick3d-helloqtquick3d-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-helloqtquick3d-imageinstancetable-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-helloqtquick3d-imageinstancetable-h.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-helloqtquick3d-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-helloqtquick3d-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-helloqtquick3d-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-helpers-qmlmodule.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-index.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-instancing-asteroid-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-instancing-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-instancing-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-instancing-instancing-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-instancing-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-instancing-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-instancing-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-instancing-simplespaceship-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-intro-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-intro-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-intro-intro-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-intro-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-intro-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-intro-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-lights-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-lights-custom-vert.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-lights-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-lights-lights-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-lights-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-lights-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-lights-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-lights-rotatingteapot-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-lights-settingsdrawer-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-lod.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-lodhelper-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-lodhelper-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-lodhelper-lodhelper-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-lodhelper-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-lodhelper-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-lodhelper-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-module.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-morphing-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-morphing-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-morphing-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-morphing-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-morphing-morphing-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-morphing-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-morphing-realslider-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-alignedparticles-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-animatedsprite-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-appsettings-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-attractorshapes-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-colorfulparticles-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-customcheckbox-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-customlabel-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-customselectionbox-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-customslider-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-dynamicbursts-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-emitandburst-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-emittercustomshapes-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-emittershapes-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-fadinginout-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-fire-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-hearttrail-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-lights-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-lineparticles-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-loggingview-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-modelblendparticles-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-modelshape-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-oceanspider-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-particles3d-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-qmldir.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-qmlmodule.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-qtlogoanimation-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-settingsview-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-snowing-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-sorting-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-speedometer-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-startupview-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-systemplaypause-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-particles3d-trailemitterburst-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-picking-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-picking-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-picking-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-picking-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-picking-materials-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-picking-picking-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-picking-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-principledmaterial-alphapane-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-principledmaterial-assets-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-principledmaterial-backgroundcurtain-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-principledmaterial-basicspane-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-principledmaterial-clearcoatpane-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-principledmaterial-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-principledmaterial-demopane-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-principledmaterial-detailspane-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-principledmaterial-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-principledmaterial-imagehelper-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-principledmaterial-imagehelper-h.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-principledmaterial-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-principledmaterial-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-principledmaterial-markdownlabel-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-principledmaterial-principledmaterial-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-principledmaterial-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-principledmaterial-refractionpane-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-principledmaterial-specialpane-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-principledmaterial-texturesourcecontrol-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-principledmaterial-verticalsectionseparator-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-proceduraltexture-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-proceduraltexture-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-proceduraltexture-gradienttexture-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-proceduraltexture-gradienttexture-h.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-proceduraltexture-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-proceduraltexture-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-proceduraltexture-proceduraltexture-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-proceduraltexture-qmldir.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-qmlmodule.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-quickball-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-quickball-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-quickball-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-quickball-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-quickball-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-quickball-quickball-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-quickitems-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-quickitems-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-quickitems-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-quickitems-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-quickitems-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-quickitems-quickitems-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-reflectionprobes-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-reflectionprobes-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-reflectionprobes-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-reflectionprobes-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-reflectionprobes-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-reflectionprobes-reflectionprobes-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-reflectionprobes-resources-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-reflectionprobes-settingspanel-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-requirements.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-runtimeloader-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-runtimeloader-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-runtimeloader-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-runtimeloader-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-runtimeloader-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-runtimeloader-runtimeloader-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-sceneeffects-assets-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-sceneeffects-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-sceneeffects-colorpicker-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-sceneeffects-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-sceneeffects-luts-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-sceneeffects-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-sceneeffects-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-sceneeffects-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-sceneeffects-sceneeffects-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-sceneeffects-sectionlayout-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-sceneeffects-settingspage-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-sceneeffects-shaders-huesaturation-frag.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-screenspacereflections-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-screenspacereflections-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-screenspacereflections-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-screenspacereflections-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-screenspacereflections-material-screenspacereflections-frag.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-screenspacereflections-materials-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-screenspacereflections-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-screenspacereflections-screenspacereflections-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-screenspacereflections-screenspacereflections-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-simplefog-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-simplefog-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-simplefog-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-simplefog-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-simplefog-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-simplefog-simplefog-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-skinning-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-skinning-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-skinning-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-skinning-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-skinning-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-skinning-simpleskinning-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-skinning-simpleskinningnew-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-skinning-skingeometry-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-skinning-skingeometry-h.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-skinning-skinning-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-submeshes-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-submeshes-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-submeshes-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-submeshes-meshes-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-submeshes-qml-distortedcube-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-submeshes-qml-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-submeshes-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-submeshes-submeshes-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-tool-balsam.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-tool-instancer.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-tool-materialeditor.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-tool-shadergen.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-view3d-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-view3d-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-view3d-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-view3d-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-view3d-qml-qrc.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-view3d-view3d-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-virtualassistant-asset-imports-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-virtualassistant-asset-imports-quick3dassets-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-virtualassistant-asset-imports-quick3dassets-robotheart-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-virtualassistant-asset-imports-quick3dassets-robotheart-qmldir.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-virtualassistant-asset-imports-quick3dassets-robotheart-robotheart-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-virtualassistant-asset-imports-quick3dassets-virtualassistant-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-virtualassistant-asset-imports-quick3dassets-virtualassistant-qmldir.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-virtualassistant-asset-imports-quick3dassets-virtualassistant-virtualassistant-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-virtualassistant-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-virtualassistant-content-app-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-virtualassistant-content-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-virtualassistant-content-controlpanel-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-virtualassistant-content-screen01-ui-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-virtualassistant-content-settingspanel-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-virtualassistant-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-virtualassistant-imports-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-virtualassistant-imports-constants-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-virtualassistant-imports-constants-constants-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-virtualassistant-imports-constants-qmldir.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-virtualassistant-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-virtualassistant-src-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-virtualassistant-virtualassistant-qmlproject.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-volumeraycaster-alpha-blending-frag.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-volumeraycaster-alpha-blending-vert.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-volumeraycaster-arcballcontroller-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-volumeraycaster-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-volumeraycaster-example.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-volumeraycaster-lineboxgeometry-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-volumeraycaster-lineboxgeometry-h.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-volumeraycaster-main-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-volumeraycaster-main-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-volumeraycaster-origingizmo-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-volumeraycaster-qmldir.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-volumeraycaster-spinner-qml.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-volumeraycaster-volumeraycaster-pro.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-volumeraycaster-volumetexturedata-cpp.html
/usr/share/doc/qt6/qtquick3d/qtquick3d-volumeraycaster-volumetexturedata-h.html
/usr/share/doc/qt6/qtquick3d/qtquick3d.index
/usr/share/doc/qt6/qtquick3d/qtquick3d.qhp
/usr/share/doc/qt6/qtquick3d/qtquick3d.qhp.sha1
/usr/share/doc/qt6/qtquick3d/quick3d-asset-conditioning-3d-assets.html
/usr/share/doc/qt6/qtquick3d/quick3d-asset-conditioning-anti-aliasing.html
/usr/share/doc/qt6/qtquick3d/quick3d-asset-conditioning-export-blender.html
/usr/share/doc/qt6/qtquick3d/quick3d-asset-conditioning-export-max.html
/usr/share/doc/qt6/qtquick3d/quick3d-asset-conditioning-export-maya.html
/usr/share/doc/qt6/qtquick3d/quick3d-asset-conditioning-export-modo.html
/usr/share/doc/qt6/qtquick3d/quick3d-asset-conditioning-ibl.html
/usr/share/doc/qt6/qtquick3d/quick3d-asset-conditioning.html
/usr/share/doc/qt6/qtquick3d/quick3d-asset-intro.html
/usr/share/doc/qt6/qtquick3d/quick3d-examples.html
/usr/share/doc/qt6/qtquick3d/quick3d-instancing.html
/usr/share/doc/qt6/qtquick3d/quick3d-lightmap.html
/usr/share/doc/qt6/qtquick3d/quick3d-morphing.html
/usr/share/doc/qt6/qtquick3d/quick3d-pbr.html
/usr/share/doc/qt6/qtquick3d/quick3d-vertex-skinning.html
/usr/share/doc/qt6/qtquick3d/style
/usr/share/doc/qt6/qtquick3d/style/offline-dark.css
/usr/share/doc/qt6/qtquick3d/style/offline-simple.css
/usr/share/doc/qt6/qtquick3d/style/offline.css
/usr/share/doc/qt6/qtquick3dphysics/examples-manifest.xml
/usr/share/doc/qt6/qtquick3dphysics/images
/usr/share/doc/qt6/qtquick3dphysics/images/arrow_bc.png
/usr/share/doc/qt6/qtquick3dphysics/images/bgrContent.png
/usr/share/doc/qt6/qtquick3dphysics/images/btn_next.png
/usr/share/doc/qt6/qtquick3dphysics/images/btn_prev.png
/usr/share/doc/qt6/qtquick3dphysics/images/bullet_dn.png
/usr/share/doc/qt6/qtquick3dphysics/images/bullet_sq.png
/usr/share/doc/qt6/qtquick3dphysics/images/cannon-example.jpg
/usr/share/doc/qt6/qtquick3dphysics/images/charactercontroller-example.jpg
/usr/share/doc/qt6/qtquick3dphysics/images/compoundshapes-example-capsulelink.jpg
/usr/share/doc/qt6/qtquick3dphysics/images/compoundshapes-example-meshlink.jpg
/usr/share/doc/qt6/qtquick3dphysics/images/compoundshapes-example.jpg
/usr/share/doc/qt6/qtquick3dphysics/images/customshapes-example.jpg
/usr/share/doc/qt6/qtquick3dphysics/images/home.png
/usr/share/doc/qt6/qtquick3dphysics/images/ico_note.png
/usr/share/doc/qt6/qtquick3dphysics/images/ico_note_attention.png
/usr/share/doc/qt6/qtquick3dphysics/images/ico_out.png
/usr/share/doc/qt6/qtquick3dphysics/images/impeller-example.jpg
/usr/share/doc/qt6/qtquick3dphysics/images/logo.png
/usr/share/doc/qt6/qtquick3dphysics/images/mass-example.jpg
/usr/share/doc/qt6/qtquick3dphysics/images/material-example.jpg
/usr/share/doc/qt6/qtquick3dphysics/images/physics.jpg
/usr/share/doc/qt6/qtquick3dphysics/images/simple-example.jpg
/usr/share/doc/qt6/qtquick3dphysics/images/used-in-examples
/usr/share/doc/qt6/qtquick3dphysics/images/used-in-examples/charactercontroller
/usr/share/doc/qt6/qtquick3dphysics/images/used-in-examples/charactercontroller/maps
/usr/share/doc/qt6/qtquick3dphysics/images/used-in-examples/charactercontroller/maps/Tape001_1K_Color.jpg
/usr/share/doc/qt6/qtquick3dphysics/images/used-in-examples/charactercontroller/maps/Tape001_1K_NormalGL.jpg
/usr/share/doc/qt6/qtquick3dphysics/images/used-in-examples/charactercontroller/maps/Tape001_1K_Roughness.jpg
/usr/share/doc/qt6/qtquick3dphysics/images/used-in-examples/charactercontroller/maps/Tiles107_1K_Color.jpg
/usr/share/doc/qt6/qtquick3dphysics/images/used-in-examples/charactercontroller/maps/Tiles107_1K_NormalGL.jpg
/usr/share/doc/qt6/qtquick3dphysics/images/used-in-examples/charactercontroller/maps/Tiles107_1K_Roughness.jpg
/usr/share/doc/qt6/qtquick3dphysics/images/used-in-examples/charactercontroller/maps/Tiles108_1K_Color.jpg
/usr/share/doc/qt6/qtquick3dphysics/images/used-in-examples/charactercontroller/maps/sign.png
/usr/share/doc/qt6/qtquick3dphysics/images/used-in-examples/charactercontroller/maps/sphere.png
/usr/share/doc/qt6/qtquick3dphysics/images/used-in-examples/customshapes
/usr/share/doc/qt6/qtquick3dphysics/images/used-in-examples/customshapes/maps
/usr/share/doc/qt6/qtquick3dphysics/images/used-in-examples/customshapes/maps/cloth-heightmap.png
/usr/share/doc/qt6/qtquick3dphysics/images/used-in-examples/customshapes/maps/numbers-normal.png
/usr/share/doc/qt6/qtquick3dphysics/images/used-in-examples/customshapes/maps/numbers.png
/usr/share/doc/qt6/qtquick3dphysics/images/used-in-examples/customshapes/maps/weave.png
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-boxshape-members.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-boxshape.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-capsuleshape-members.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-capsuleshape.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-charactercontroller-members.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-charactercontroller.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-collisionshape-members.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-collisionshape.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-convexmeshshape-members.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-convexmeshshape.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-dynamicrigidbody-members.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-dynamicrigidbody.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-heightfieldshape-members.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-heightfieldshape.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-physicsbody-members.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-physicsbody.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-physicsmaterial-members.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-physicsmaterial.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-physicsnode-members.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-physicsnode.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-physicsworld-members.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-physicsworld.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-planeshape-members.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-planeshape.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-sphereshape-members.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-sphereshape.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-staticrigidbody-members.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-staticrigidbody.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-trianglemeshshape-members.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-trianglemeshshape.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-triggerbody-members.html
/usr/share/doc/qt6/qtquick3dphysics/qml-qtquick3d-physics-triggerbody.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3d-physics-qmlmodule.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-attribution-physx.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-cannon-box-qml.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-cannon-cannon-pro.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-cannon-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-cannon-crosshair-qml.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-cannon-example.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-cannon-main-cpp.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-cannon-main-qml.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-cannon-qml-qrc.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-cannon-sphere-qml.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-changes-6-5.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-charactercontroller-building-qml.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-charactercontroller-charactercontroller-pro.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-charactercontroller-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-charactercontroller-example.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-charactercontroller-main-cpp.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-charactercontroller-main-qml.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-charactercontroller-qml-qrc.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-charactercontroller-wasd-qml.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-compoundshapes-capsulelink-qml.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-compoundshapes-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-compoundshapes-compoundshapes-pro.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-compoundshapes-example.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-compoundshapes-main-cpp.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-compoundshapes-main-qml.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-compoundshapes-meshlink-qml.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-compoundshapes-qml-qrc.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-compoundshapes-resources-qrc.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-cooking.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-customshapes-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-customshapes-customshapes-pro.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-customshapes-example.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-customshapes-main-cpp.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-customshapes-main-qml.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-customshapes-qml-qrc.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-customshapes-resources-qrc.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-impeller-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-impeller-example.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-impeller-impeller-pro.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-impeller-main-cpp.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-impeller-main-qml.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-impeller-qml-qrc.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-index.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-mass-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-mass-example.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-mass-main-cpp.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-mass-main-qml.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-mass-mass-pro.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-mass-qml-qrc.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-mass-rolypoly-qml.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-mass-sphere-qml.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-material-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-material-example.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-material-main-cpp.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-material-main-qml.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-material-material-pro.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-material-qml-qrc.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-shapes-bodies.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-simple-cmakelists-txt.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-simple-example.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-simple-main-cpp.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-simple-main-qml.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-simple-qml-qrc.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-simple-simple-pro.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics-units.html
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics.index
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics.qhp
/usr/share/doc/qt6/qtquick3dphysics/qtquick3dphysics.qhp.sha1
/usr/share/doc/qt6/qtquick3dphysics/quick3dphysics-examples.html
/usr/share/doc/qt6/qtquick3dphysics/style
/usr/share/doc/qt6/qtquick3dphysics/style/offline-dark.css
/usr/share/doc/qt6/qtquick3dphysics/style/offline-simple.css
/usr/share/doc/qt6/qtquick3dphysics/style/offline.css
/usr/share/doc/qt6/qtquickcontrols/examples-manifest.xml
/usr/share/doc/qt6/qtquickcontrols/images
/usr/share/doc/qt6/qtquickcontrols/images/applicationwindow-background.png
/usr/share/doc/qt6/qtquickcontrols/images/applicationwindow-overlay-modal.png
/usr/share/doc/qt6/qtquickcontrols/images/applicationwindow-overlay.png
/usr/share/doc/qt6/qtquickcontrols/images/arrow_bc.png
/usr/share/doc/qt6/qtquickcontrols/images/bgrContent.png
/usr/share/doc/qt6/qtquickcontrols/images/btn_next.png
/usr/share/doc/qt6/qtquickcontrols/images/btn_prev.png
/usr/share/doc/qt6/qtquickcontrols/images/bullet_dn.png
/usr/share/doc/qt6/qtquickcontrols/images/bullet_sq.png
/usr/share/doc/qt6/qtquickcontrols/images/button-background-checked-disabled.9.png
/usr/share/doc/qt6/qtquickcontrols/images/button-background-checked-focused.9.png
/usr/share/doc/qt6/qtquickcontrols/images/button-background-checked-hovered.9.png
/usr/share/doc/qt6/qtquickcontrols/images/button-background-checked.9.png
/usr/share/doc/qt6/qtquickcontrols/images/button-background-disabled.9.png
/usr/share/doc/qt6/qtquickcontrols/images/button-background-flat-checked.9.png
/usr/share/doc/qt6/qtquickcontrols/images/button-background-flat-disabled.9.png
/usr/share/doc/qt6/qtquickcontrols/images/button-background-flat-hovered.9.png
/usr/share/doc/qt6/qtquickcontrols/images/button-background-flat-pressed.9.png
/usr/share/doc/qt6/qtquickcontrols/images/button-background-flat.9.png
/usr/share/doc/qt6/qtquickcontrols/images/button-background-focused.9.png
/usr/share/doc/qt6/qtquickcontrols/images/button-background-highlighted-checked.9.png
/usr/share/doc/qt6/qtquickcontrols/images/button-background-highlighted-disabled.9.png
/usr/share/doc/qt6/qtquickcontrols/images/button-background-highlighted-focused.9.png
/usr/share/doc/qt6/qtquickcontrols/images/button-background-highlighted-hovered.9.png
/usr/share/doc/qt6/qtquickcontrols/images/button-background-highlighted-pressed.9.png
/usr/share/doc/qt6/qtquickcontrols/images/button-background-highlighted.9.png
/usr/share/doc/qt6/qtquickcontrols/images/button-background-hovered.9.png
/usr/share/doc/qt6/qtquickcontrols/images/button-background-pressed.9.png
/usr/share/doc/qt6/qtquickcontrols/images/button-background.9.png
/usr/share/doc/qt6/qtquickcontrols/images/checkbox-indicator-checked-focused.png
/usr/share/doc/qt6/qtquickcontrols/images/checkbox-indicator-checked-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/checkbox-indicator-checked-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/checkbox-indicator-checked.png
/usr/share/doc/qt6/qtquickcontrols/images/checkbox-indicator-disabled.png
/usr/share/doc/qt6/qtquickcontrols/images/checkbox-indicator-focused.png
/usr/share/doc/qt6/qtquickcontrols/images/checkbox-indicator-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/checkbox-indicator-partially-checked-focused.png
/usr/share/doc/qt6/qtquickcontrols/images/checkbox-indicator-partially-checked-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/checkbox-indicator-partially-checked-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/checkbox-indicator-partially-checked.png
/usr/share/doc/qt6/qtquickcontrols/images/checkbox-indicator-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/checkbox-indicator.png
/usr/share/doc/qt6/qtquickcontrols/images/checkdelegate-background-disabled.9.png
/usr/share/doc/qt6/qtquickcontrols/images/checkdelegate-background-focused.9.png
/usr/share/doc/qt6/qtquickcontrols/images/checkdelegate-background-hovered.9.png
/usr/share/doc/qt6/qtquickcontrols/images/checkdelegate-background-pressed.9.png
/usr/share/doc/qt6/qtquickcontrols/images/checkdelegate-background.9.png
/usr/share/doc/qt6/qtquickcontrols/images/checkdelegate-indicator-checked-focused.png
/usr/share/doc/qt6/qtquickcontrols/images/checkdelegate-indicator-checked-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/checkdelegate-indicator-checked-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/checkdelegate-indicator-checked.png
/usr/share/doc/qt6/qtquickcontrols/images/checkdelegate-indicator-disabled.png
/usr/share/doc/qt6/qtquickcontrols/images/checkdelegate-indicator-focused.png
/usr/share/doc/qt6/qtquickcontrols/images/checkdelegate-indicator-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/checkdelegate-indicator-partially-checked-focused.png
/usr/share/doc/qt6/qtquickcontrols/images/checkdelegate-indicator-partially-checked-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/checkdelegate-indicator-partially-checked-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/checkdelegate-indicator-partially-checked.png
/usr/share/doc/qt6/qtquickcontrols/images/checkdelegate-indicator-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/checkdelegate-indicator.png
/usr/share/doc/qt6/qtquickcontrols/images/combobox-background-disabled.9.png
/usr/share/doc/qt6/qtquickcontrols/images/combobox-background-editable-disabled.9.png
/usr/share/doc/qt6/qtquickcontrols/images/combobox-background-editable-focused.9.png
/usr/share/doc/qt6/qtquickcontrols/images/combobox-background-editable.9.png
/usr/share/doc/qt6/qtquickcontrols/images/combobox-background-focused.9.png
/usr/share/doc/qt6/qtquickcontrols/images/combobox-background-hovered.9.png
/usr/share/doc/qt6/qtquickcontrols/images/combobox-background-open.9.png
/usr/share/doc/qt6/qtquickcontrols/images/combobox-background-pressed.9.png
/usr/share/doc/qt6/qtquickcontrols/images/combobox-background.9.png
/usr/share/doc/qt6/qtquickcontrols/images/combobox-indicator-disabled.png
/usr/share/doc/qt6/qtquickcontrols/images/combobox-indicator-editable-disabled.png
/usr/share/doc/qt6/qtquickcontrols/images/combobox-indicator-editable-mirrored-disabled.png
/usr/share/doc/qt6/qtquickcontrols/images/combobox-indicator-editable-mirrored.png
/usr/share/doc/qt6/qtquickcontrols/images/combobox-indicator-editable.png
/usr/share/doc/qt6/qtquickcontrols/images/combobox-indicator.png
/usr/share/doc/qt6/qtquickcontrols/images/combobox-popup.9.png
/usr/share/doc/qt6/qtquickcontrols/images/delaybutton-background-checked-focused.9.png
/usr/share/doc/qt6/qtquickcontrols/images/delaybutton-background-checked-hovered.9.png
/usr/share/doc/qt6/qtquickcontrols/images/delaybutton-background-checked.9.png
/usr/share/doc/qt6/qtquickcontrols/images/delaybutton-background-disabled-checked.9.png
/usr/share/doc/qt6/qtquickcontrols/images/delaybutton-background-disabled.9.png
/usr/share/doc/qt6/qtquickcontrols/images/delaybutton-background-focused.9.png
/usr/share/doc/qt6/qtquickcontrols/images/delaybutton-background-hovered.9.png
/usr/share/doc/qt6/qtquickcontrols/images/delaybutton-background-pressed.9.png
/usr/share/doc/qt6/qtquickcontrols/images/delaybutton-background.9.png
/usr/share/doc/qt6/qtquickcontrols/images/delaybutton-mask.9.png
/usr/share/doc/qt6/qtquickcontrols/images/delaybutton-progress-disabled.9.png
/usr/share/doc/qt6/qtquickcontrols/images/delaybutton-progress.9.png
/usr/share/doc/qt6/qtquickcontrols/images/dial-background-disabled.png
/usr/share/doc/qt6/qtquickcontrols/images/dial-background-focused.png
/usr/share/doc/qt6/qtquickcontrols/images/dial-background.png
/usr/share/doc/qt6/qtquickcontrols/images/dial-handle-disabled.png
/usr/share/doc/qt6/qtquickcontrols/images/dial-handle-focused-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/dial-handle-focused-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/dial-handle-focused.png
/usr/share/doc/qt6/qtquickcontrols/images/dial-handle-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/dial-handle-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/dial-handle.png
/usr/share/doc/qt6/qtquickcontrols/images/dialog-background.9.png
/usr/share/doc/qt6/qtquickcontrols/images/dialog-overlay-modal.png
/usr/share/doc/qt6/qtquickcontrols/images/dialog-overlay.png
/usr/share/doc/qt6/qtquickcontrols/images/dialogbuttonbox-background.9.png
/usr/share/doc/qt6/qtquickcontrols/images/drawer-background-bottom.9.png
/usr/share/doc/qt6/qtquickcontrols/images/drawer-background-left.9.png
/usr/share/doc/qt6/qtquickcontrols/images/drawer-background-right.9.png
/usr/share/doc/qt6/qtquickcontrols/images/drawer-background-top.9.png
/usr/share/doc/qt6/qtquickcontrols/images/drawer-overlay-modal.png
/usr/share/doc/qt6/qtquickcontrols/images/drawer-overlay.png
/usr/share/doc/qt6/qtquickcontrols/images/frame-background.9.png
/usr/share/doc/qt6/qtquickcontrols/images/groupbox-background.9.png
/usr/share/doc/qt6/qtquickcontrols/images/groupbox-title.9.png
/usr/share/doc/qt6/qtquickcontrols/images/home.png
/usr/share/doc/qt6/qtquickcontrols/images/ico_note.png
/usr/share/doc/qt6/qtquickcontrols/images/ico_note_attention.png
/usr/share/doc/qt6/qtquickcontrols/images/ico_out.png
/usr/share/doc/qt6/qtquickcontrols/images/itemdelegate-background-disabled.9.png
/usr/share/doc/qt6/qtquickcontrols/images/itemdelegate-background-focused.9.png
/usr/share/doc/qt6/qtquickcontrols/images/itemdelegate-background-highlighted.9.png
/usr/share/doc/qt6/qtquickcontrols/images/itemdelegate-background-hovered.9.png
/usr/share/doc/qt6/qtquickcontrols/images/itemdelegate-background-pressed.9.png
/usr/share/doc/qt6/qtquickcontrols/images/itemdelegate-background.9.png
/usr/share/doc/qt6/qtquickcontrols/images/logo.png
/usr/share/doc/qt6/qtquickcontrols/images/menu-background.9.png
/usr/share/doc/qt6/qtquickcontrols/images/menuitem-arrow-disabled.png
/usr/share/doc/qt6/qtquickcontrols/images/menuitem-arrow-mirrored-disabled.png
/usr/share/doc/qt6/qtquickcontrols/images/menuitem-arrow-mirrored.png
/usr/share/doc/qt6/qtquickcontrols/images/menuitem-arrow.png
/usr/share/doc/qt6/qtquickcontrols/images/menuitem-background-highlighted.9.png
/usr/share/doc/qt6/qtquickcontrols/images/menuitem-background.9.png
/usr/share/doc/qt6/qtquickcontrols/images/menuitem-indicator-checked-focused.png
/usr/share/doc/qt6/qtquickcontrols/images/menuitem-indicator-checked-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/menuitem-indicator-checked-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/menuitem-indicator-checked.png
/usr/share/doc/qt6/qtquickcontrols/images/menuitem-indicator-disabled.png
/usr/share/doc/qt6/qtquickcontrols/images/menuitem-indicator-focused.png
/usr/share/doc/qt6/qtquickcontrols/images/menuitem-indicator-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/menuitem-indicator-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/menuitem-indicator.png
/usr/share/doc/qt6/qtquickcontrols/images/menuseparator-separator.9.png
/usr/share/doc/qt6/qtquickcontrols/images/page-background.png
/usr/share/doc/qt6/qtquickcontrols/images/pageindicator-delegate-current.png
/usr/share/doc/qt6/qtquickcontrols/images/pageindicator-delegate-disabled-current.png
/usr/share/doc/qt6/qtquickcontrols/images/pageindicator-delegate-disabled.png
/usr/share/doc/qt6/qtquickcontrols/images/pageindicator-delegate-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/pageindicator-delegate.png
/usr/share/doc/qt6/qtquickcontrols/images/pane-background.9.png
/usr/share/doc/qt6/qtquickcontrols/images/popup-background.9.png
/usr/share/doc/qt6/qtquickcontrols/images/popup-overlay-modal.png
/usr/share/doc/qt6/qtquickcontrols/images/popup-overlay.png
/usr/share/doc/qt6/qtquickcontrols/images/progressbar-background.9.png
/usr/share/doc/qt6/qtquickcontrols/images/progressbar-mask.9.png
/usr/share/doc/qt6/qtquickcontrols/images/progressbar-progress.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcalendar-eventcalendar.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-applicationwindow-wireframe.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-attachedstyleproperties.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-automotive.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-basic-popup-property-propagation.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-basic.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-busyindicator-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-busyindicator.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-busyindicator.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-button-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-button-flat.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-button-highlighted.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-button-icononly.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-button-textbesideicon.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-button-textonly.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-button-textundericon.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-button.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-chattutorial-chapter1.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-chattutorial-chapter2-listview-header.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-chattutorial-chapter2.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-chattutorial-chapter3-listview-header.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-chattutorial-chapter3-view-margins.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-chattutorial-chapter3.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-chattutorial-chapter4-long-message.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-chattutorial-chapter4-message-timestamp.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-chattutorial-chapter4.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-chattutorial-chapter5-contacts-material-dark.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-chattutorial-chapter5-contacts-material-test.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-chattutorial-chapter5-contacts-material.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-chattutorial-chapter5-contacts-universal-dark.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-chattutorial-chapter5-contacts-universal.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-chattutorial-chapter5-conversations-material-dark.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-chattutorial-chapter5-conversations-material-test.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-chattutorial-chapter5-conversations-material.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-chattutorial-chapter5-conversations-universal-dark.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-chattutorial-chapter5-conversations-universal.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-checkbox-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-checkbox-group.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-checkbox-tristate.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-checkbox.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-checkdelegate-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-checkdelegate-tristate.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-checkdelegate.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-combobox-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-combobox.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-contactlist.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-control.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-customize-buttons.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-dayofweekrow-layout.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-dayofweekrow.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-delaybutton-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-delaybutton.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-dial-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-dial-inputmode.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-dial-no-wrap.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-dial-wrap.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-dial.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-dialogbuttonbox.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-drawer-expanded-wireframe.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-drawer.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-filesystemexplorer.webp
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-flatstyle-creator.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-flatstyle.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-frame-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-frame.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-fusion-dark.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-fusion-light.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-fusion-palettes.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-fusion-violet.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-gallery-drawer.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-gallery-menu.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-gallery-welcome.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-groupbox-checkable.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-groupbox-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-groupbox.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-imagine-9-patch-4x.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-imagine-9-patch-inset-boundaries.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-imagine-9-patch-inset.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-imagine-9-patch-resized-padding.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-imagine-9-patch-resized-stretchable.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-imagine-9-patch-size.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-imagine-customization-dark.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-imagine.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-ios-dark.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-ios-light.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-itemdelegate-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-itemdelegate.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-label-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-label.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-macos-dark.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-macos-light.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-material-accent.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-material-attributes.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-material-background.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-material-dark.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-material-elevation.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-material-foreground.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-material-light.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-material-purple.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-material-theme.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-material-variant-dense.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-material-variant-normal.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-menu-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-menu.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-menubar-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-menubar.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-menuseparator.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-monthgrid-layout.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-monthgrid.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-page-wireframe.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-pageindicator-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-pageindicator.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-pane-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-pane.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-popup-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-popup-settings.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-popup-transformorigin.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-popup.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-progressbar-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-progressbar-indeterminate.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-progressbar.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-radiobutton-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-radiobutton.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-radiodelegate-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-radiodelegate.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-rangeslider-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-rangeslider.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-roundbutton.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-scrollbar-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-scrollbar-non-attached.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-scrollbar-nosnap.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-scrollbar-snapalways.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-scrollbar-snaponrelease.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-scrollbar.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-scrollindicator-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-scrollindicator-non-attached.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-scrollindicator.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-scrollview-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-scrollview-wireframe.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-scrollview.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-selectionrectangle.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-slider-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-slider-nosnap.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-slider-snapalways.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-slider-snaponrelease.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-slider.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-spinbox-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-spinbox-double.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-spinbox-textual.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-spinbox.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-splitview-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-stackview-pop.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-stackview-push.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-stackview-replace.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-stackview-unwind.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-stackview-visible.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-stackview-wireframe.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-styles.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-swipedelegate-behind.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-swipedelegate-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-swipedelegate-leading-trailing.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-swipedelegate.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-swipeview-wireframe.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-swipeview.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-switch-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-switch.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-switch.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-switchdelegate-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-switchdelegate.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-tabbar-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-tabbar-explicit.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-tabbar-flickable.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-tabbar-wireframe.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-tabbutton.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-textarea-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-textarea-scrollable.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-textarea.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-texteditor-desktop.jpg
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-texteditor-touch.jpg
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-textfield-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-textfield-disabled.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-textfield-focused.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-textfield-normal.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-textfield.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-todolist.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-toolbar-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-toolbar.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-toolbutton-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-toolbutton.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-toolseparator-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-toolseparator.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-tooltip-slider.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-tooltip.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-treeviewdelegate.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-tumbler-custom.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-tumbler-wrap.gif
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-tumbler.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-universal-accent.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-universal-attributes.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-universal-background.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-universal-dark.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-universal-foreground.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-universal-light.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-universal-theme.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-universal-violet.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-wearable.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-weeknumbercolumn-layout.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-weeknumbercolumn.png
/usr/share/doc/qt6/qtquickcontrols/images/qtquickcontrols-windows.png
/usr/share/doc/qt6/qtquickcontrols/images/radiobutton-indicator-checked-focused.png
/usr/share/doc/qt6/qtquickcontrols/images/radiobutton-indicator-checked-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/radiobutton-indicator-checked-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/radiobutton-indicator-checked.png
/usr/share/doc/qt6/qtquickcontrols/images/radiobutton-indicator-disabled.png
/usr/share/doc/qt6/qtquickcontrols/images/radiobutton-indicator-focused.png
/usr/share/doc/qt6/qtquickcontrols/images/radiobutton-indicator-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/radiobutton-indicator-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/radiobutton-indicator.png
/usr/share/doc/qt6/qtquickcontrols/images/radiodelegate-background-disabled.9.png
/usr/share/doc/qt6/qtquickcontrols/images/radiodelegate-background-focused.9.png
/usr/share/doc/qt6/qtquickcontrols/images/radiodelegate-background-hovered.9.png
/usr/share/doc/qt6/qtquickcontrols/images/radiodelegate-background-pressed.9.png
/usr/share/doc/qt6/qtquickcontrols/images/radiodelegate-background.9.png
/usr/share/doc/qt6/qtquickcontrols/images/radiodelegate-indicator-checked-focused.png
/usr/share/doc/qt6/qtquickcontrols/images/radiodelegate-indicator-checked-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/radiodelegate-indicator-checked-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/radiodelegate-indicator-checked.png
/usr/share/doc/qt6/qtquickcontrols/images/radiodelegate-indicator-disabled.png
/usr/share/doc/qt6/qtquickcontrols/images/radiodelegate-indicator-focused.png
/usr/share/doc/qt6/qtquickcontrols/images/radiodelegate-indicator-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/radiodelegate-indicator-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/radiodelegate-indicator.png
/usr/share/doc/qt6/qtquickcontrols/images/rangeslider-background-horizontal.9.png
/usr/share/doc/qt6/qtquickcontrols/images/rangeslider-background-vertical.9.png
/usr/share/doc/qt6/qtquickcontrols/images/rangeslider-handle-disabled.png
/usr/share/doc/qt6/qtquickcontrols/images/rangeslider-handle-focused-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/rangeslider-handle-focused-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/rangeslider-handle-focused.png
/usr/share/doc/qt6/qtquickcontrols/images/rangeslider-handle-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/rangeslider-handle-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/rangeslider-handle.png
/usr/share/doc/qt6/qtquickcontrols/images/rangeslider-progress-horizontal-disabled.9.png
/usr/share/doc/qt6/qtquickcontrols/images/rangeslider-progress-horizontal.9.png
/usr/share/doc/qt6/qtquickcontrols/images/rangeslider-progress-vertical-disabled.9.png
/usr/share/doc/qt6/qtquickcontrols/images/rangeslider-progress-vertical.9.png
/usr/share/doc/qt6/qtquickcontrols/images/roundbutton-background-checked-focused.png
/usr/share/doc/qt6/qtquickcontrols/images/roundbutton-background-checked-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/roundbutton-background-checked.png
/usr/share/doc/qt6/qtquickcontrols/images/roundbutton-background-disabled-checked.png
/usr/share/doc/qt6/qtquickcontrols/images/roundbutton-background-disabled.png
/usr/share/doc/qt6/qtquickcontrols/images/roundbutton-background-focused.png
/usr/share/doc/qt6/qtquickcontrols/images/roundbutton-background-highlighted-focused.png
/usr/share/doc/qt6/qtquickcontrols/images/roundbutton-background-highlighted-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/roundbutton-background-highlighted-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/roundbutton-background-highlighted.png
/usr/share/doc/qt6/qtquickcontrols/images/roundbutton-background-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/roundbutton-background-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/roundbutton-background.png
/usr/share/doc/qt6/qtquickcontrols/images/scrollbar-handle-disabled.png
/usr/share/doc/qt6/qtquickcontrols/images/scrollbar-handle-interactive-disabled.png
/usr/share/doc/qt6/qtquickcontrols/images/scrollbar-handle-interactive-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/scrollbar-handle-interactive-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/scrollbar-handle-interactive.png
/usr/share/doc/qt6/qtquickcontrols/images/scrollbar-handle.png
/usr/share/doc/qt6/qtquickcontrols/images/scrollindicator-handle.png
/usr/share/doc/qt6/qtquickcontrols/images/slider-background-horizontal.9.png
/usr/share/doc/qt6/qtquickcontrols/images/slider-background-vertical.9.png
/usr/share/doc/qt6/qtquickcontrols/images/slider-handle-disabled.png
/usr/share/doc/qt6/qtquickcontrols/images/slider-handle-focused-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/slider-handle-focused-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/slider-handle-focused.png
/usr/share/doc/qt6/qtquickcontrols/images/slider-handle-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/slider-handle-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/slider-handle.png
/usr/share/doc/qt6/qtquickcontrols/images/slider-progress-horizontal-disabled.9.png
/usr/share/doc/qt6/qtquickcontrols/images/slider-progress-horizontal.9.png
/usr/share/doc/qt6/qtquickcontrols/images/slider-progress-vertical-disabled.9.png
/usr/share/doc/qt6/qtquickcontrols/images/slider-progress-vertical.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-background-disabled.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-background-editable.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-background-focused.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-background.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-indicator-down-disabled.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-indicator-down-editable-focused.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-indicator-down-editable-hovered.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-indicator-down-editable-mirrored.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-indicator-down-editable-pressed.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-indicator-down-editable.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-indicator-down-focused.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-indicator-down-hovered.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-indicator-down-mirrored.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-indicator-down-pressed.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-indicator-down.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-indicator-up-disabled.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-indicator-up-editable-focused.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-indicator-up-editable-hovered.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-indicator-up-editable-mirrored.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-indicator-up-editable-pressed.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-indicator-up-editable.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-indicator-up-focused.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-indicator-up-hovered.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-indicator-up-mirrored.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-indicator-up-pressed.9.png
/usr/share/doc/qt6/qtquickcontrols/images/spinbox-indicator-up.9.png
/usr/share/doc/qt6/qtquickcontrols/images/swipedelegate-background-disabled.9.png
/usr/share/doc/qt6/qtquickcontrols/images/swipedelegate-background-focused.9.png
/usr/share/doc/qt6/qtquickcontrols/images/swipedelegate-background-hovered.9.png
/usr/share/doc/qt6/qtquickcontrols/images/swipedelegate-background-pressed.9.png
/usr/share/doc/qt6/qtquickcontrols/images/swipedelegate-background.9.png
/usr/share/doc/qt6/qtquickcontrols/images/switch-handle-disabled.png
/usr/share/doc/qt6/qtquickcontrols/images/switch-handle-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/switch-handle.png
/usr/share/doc/qt6/qtquickcontrols/images/switch-indicator-checked-focused.png
/usr/share/doc/qt6/qtquickcontrols/images/switch-indicator-checked-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/switch-indicator-checked-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/switch-indicator-checked.png
/usr/share/doc/qt6/qtquickcontrols/images/switch-indicator-disabled.png
/usr/share/doc/qt6/qtquickcontrols/images/switch-indicator-focused.png
/usr/share/doc/qt6/qtquickcontrols/images/switch-indicator-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/switch-indicator-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/switch-indicator.png
/usr/share/doc/qt6/qtquickcontrols/images/switchdelegate-background-disabled.9.png
/usr/share/doc/qt6/qtquickcontrols/images/switchdelegate-background-focused.9.png
/usr/share/doc/qt6/qtquickcontrols/images/switchdelegate-background-hovered.9.png
/usr/share/doc/qt6/qtquickcontrols/images/switchdelegate-background-pressed.9.png
/usr/share/doc/qt6/qtquickcontrols/images/switchdelegate-background.9.png
/usr/share/doc/qt6/qtquickcontrols/images/switchdelegate-handle-disabled.png
/usr/share/doc/qt6/qtquickcontrols/images/switchdelegate-handle.png
/usr/share/doc/qt6/qtquickcontrols/images/switchdelegate-indicator-checked-focused.png
/usr/share/doc/qt6/qtquickcontrols/images/switchdelegate-indicator-checked-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/switchdelegate-indicator-checked-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/switchdelegate-indicator-checked.png
/usr/share/doc/qt6/qtquickcontrols/images/switchdelegate-indicator-disabled.png
/usr/share/doc/qt6/qtquickcontrols/images/switchdelegate-indicator-focused.png
/usr/share/doc/qt6/qtquickcontrols/images/switchdelegate-indicator-hovered.png
/usr/share/doc/qt6/qtquickcontrols/images/switchdelegate-indicator-pressed.png
/usr/share/doc/qt6/qtquickcontrols/images/switchdelegate-indicator.png
/usr/share/doc/qt6/qtquickcontrols/images/tabbar-background.png
/usr/share/doc/qt6/qtquickcontrols/images/tabbutton-background-checked.9.png
/usr/share/doc/qt6/qtquickcontrols/images/tabbutton-background-disabled-checked.9.png
/usr/share/doc/qt6/qtquickcontrols/images/tabbutton-background-disabled.9.png
/usr/share/doc/qt6/qtquickcontrols/images/tabbutton-background-hovered.9.png
/usr/share/doc/qt6/qtquickcontrols/images/tabbutton-background-pressed.9.png
/usr/share/doc/qt6/qtquickcontrols/images/tabbutton-background.9.png
/usr/share/doc/qt6/qtquickcontrols/images/textarea-background-disabled.9.png
/usr/share/doc/qt6/qtquickcontrols/images/textarea-background-focused.9.png
/usr/share/doc/qt6/qtquickcontrols/images/textarea-background.9.png
/usr/share/doc/qt6/qtquickcontrols/images/textfield-background-disabled.9.png
/usr/share/doc/qt6/qtquickcontrols/images/textfield-background-focused.9.png
/usr/share/doc/qt6/qtquickcontrols/images/textfield-background.9.png
/usr/share/doc/qt6/qtquickcontrols/images/toolbar-background.png
/usr/share/doc/qt6/qtquickcontrols/images/toolbutton-background-checked-focused.9.png
/usr/share/doc/qt6/qtquickcontrols/images/toolbutton-background-checked-hovered.9.png
/usr/share/doc/qt6/qtquickcontrols/images/toolbutton-background-checked.9.png
/usr/share/doc/qt6/qtquickcontrols/images/toolbutton-background-disabled-checked.9.png
/usr/share/doc/qt6/qtquickcontrols/images/toolbutton-background-focused.9.png
/usr/share/doc/qt6/qtquickcontrols/images/toolbutton-background-hovered.9.png
/usr/share/doc/qt6/qtquickcontrols/images/toolbutton-background-pressed.9.png
/usr/share/doc/qt6/qtquickcontrols/images/toolbutton-background.9.png
/usr/share/doc/qt6/qtquickcontrols/images/toolseparator-separator-horizontal.9.png
/usr/share/doc/qt6/qtquickcontrols/images/toolseparator-separator-vertical.9.png
/usr/share/doc/qt6/qtquickcontrols/images/tooltip-background.9.png
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-abstractbutton-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-abstractbutton.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-action-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-action.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-actiongroup-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-actiongroup.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-applicationwindow-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-applicationwindow.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-busyindicator-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-busyindicator.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-button-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-button.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-buttongroup-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-buttongroup.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-calendar-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-calendar.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-calendarmodel-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-calendarmodel.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-checkbox-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-checkbox.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-checkdelegate-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-checkdelegate.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-combobox-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-combobox.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-container-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-container.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-control-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-control.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-dayofweekrow-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-dayofweekrow.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-delaybutton-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-delaybutton.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-dial-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-dial.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-dialog-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-dialog.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-dialogbuttonbox-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-dialogbuttonbox.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-drawer-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-drawer.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-frame-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-frame.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-groupbox-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-groupbox.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-horizontalheaderview-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-horizontalheaderview.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-itemdelegate-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-itemdelegate.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-label-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-label.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-menu-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-menu.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-menubar-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-menubar.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-menubaritem-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-menubaritem.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-menuitem-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-menuitem.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-menuseparator-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-menuseparator.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-monthgrid-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-monthgrid.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-overlay-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-overlay.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-page-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-page.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-pageindicator-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-pageindicator.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-pane-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-pane.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-popup-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-popup.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-progressbar-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-progressbar.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-radiobutton-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-radiobutton.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-radiodelegate-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-radiodelegate.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-rangeslider-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-rangeslider.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-roundbutton-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-roundbutton.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-scrollbar-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-scrollbar.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-scrollindicator-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-scrollindicator.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-scrollview-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-scrollview.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-selectionrectangle-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-selectionrectangle.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-slider-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-slider.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-spinbox-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-spinbox.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-splithandle-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-splithandle.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-splitview-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-splitview.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-stackview-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-stackview.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-swipedelegate-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-swipedelegate.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-swipeview-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-swipeview.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-switch-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-switch.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-switchdelegate-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-switchdelegate.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-tabbar-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-tabbar.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-tabbutton-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-tabbutton.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-textarea-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-textarea.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-textfield-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-textfield.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-toolbar-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-toolbar.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-toolbutton-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-toolbutton.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-toolseparator-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-toolseparator.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-tooltip-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-tooltip.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-treeviewdelegate-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-treeviewdelegate.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-tumbler-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-tumbler.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-verticalheaderview-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-verticalheaderview.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-weeknumbercolumn-members.html
/usr/share/doc/qt6/qtquickcontrols/qml-qtquick-controls-weeknumbercolumn.html
/usr/share/doc/qt6/qtquickcontrols/qquickattachedpropertypropagator-members.html
/usr/share/doc/qt6/qtquickcontrols/qquickattachedpropertypropagator.html
/usr/share/doc/qt6/qtquickcontrols/qquickstyle-members.html
/usr/share/doc/qt6/qtquickcontrols/qquickstyle.html
/usr/share/doc/qt6/qtquickcontrols/qtquick-controls-qmlmodule.html
/usr/share/doc/qt6/qtquickcontrols/qtquick-templates-qmlmodule.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-attachedstyleproperties-example.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-attribution-shadow-angular-material.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-basic.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-buttons.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-changes-qt6.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-chattutorial-example.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-configuration.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-contactlist-example.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-containers.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-customize.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-delegates.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-deployment.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-environment.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-eventcalendar-example.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-examples.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-fileselectors.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-filesystemexplorer-example.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-flatstyle-example.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-focus.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-fusion.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-gallery-example.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-gettingstarted.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-guidelines.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-icons.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-imagine-automotive-example.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-imagine.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-index.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-indicators.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-input.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-ios-todolist-example.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-ios.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-macos.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-material.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-menus.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-navigation.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-popups.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-separators.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-styles.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-texteditor-example.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-universal.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-wearable-example.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols-windows.html
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols.index
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols.qhp
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols.qhp.sha1
/usr/share/doc/qt6/qtquickcontrols/qtquickcontrols2-module.html
/usr/share/doc/qt6/qtquickcontrols/qtquicktemplates2-index.html
/usr/share/doc/qt6/qtquickcontrols/style
/usr/share/doc/qt6/qtquickcontrols/style/offline-dark.css
/usr/share/doc/qt6/qtquickcontrols/style/offline-simple.css
/usr/share/doc/qt6/qtquickcontrols/style/offline.css
/usr/share/doc/qt6/qtquickdialogs/images
/usr/share/doc/qt6/qtquickdialogs/images/arrow_bc.png
/usr/share/doc/qt6/qtquickdialogs/images/bgrContent.png
/usr/share/doc/qt6/qtquickdialogs/images/btn_next.png
/usr/share/doc/qt6/qtquickdialogs/images/btn_prev.png
/usr/share/doc/qt6/qtquickdialogs/images/bullet_dn.png
/usr/share/doc/qt6/qtquickdialogs/images/bullet_sq.png
/usr/share/doc/qt6/qtquickdialogs/images/home.png
/usr/share/doc/qt6/qtquickdialogs/images/ico_note.png
/usr/share/doc/qt6/qtquickdialogs/images/ico_note_attention.png
/usr/share/doc/qt6/qtquickdialogs/images/ico_out.png
/usr/share/doc/qt6/qtquickdialogs/images/logo.png
/usr/share/doc/qt6/qtquickdialogs/images/qtquickdialogs-colordialog-gtk.png
/usr/share/doc/qt6/qtquickdialogs/images/qtquickdialogs-filedialog-gtk.png
/usr/share/doc/qt6/qtquickdialogs/images/qtquickdialogs-folderdialog-gtk.png
/usr/share/doc/qt6/qtquickdialogs/images/qtquickdialogs-fontdialog-gtk.png
/usr/share/doc/qt6/qtquickdialogs/images/qtquickdialogs-messagedialog-android.png
/usr/share/doc/qt6/qtquickdialogs/images/qtquickdialogs-messagedialog-informative-android.png
/usr/share/doc/qt6/qtquickdialogs/qml-qtquick-dialogs-colordialog-members.html
/usr/share/doc/qt6/qtquickdialogs/qml-qtquick-dialogs-colordialog.html
/usr/share/doc/qt6/qtquickdialogs/qml-qtquick-dialogs-dialog-members.html
/usr/share/doc/qt6/qtquickdialogs/qml-qtquick-dialogs-dialog.html
/usr/share/doc/qt6/qtquickdialogs/qml-qtquick-dialogs-filedialog-members.html
/usr/share/doc/qt6/qtquickdialogs/qml-qtquick-dialogs-filedialog-obsolete.html
/usr/share/doc/qt6/qtquickdialogs/qml-qtquick-dialogs-filedialog.html
/usr/share/doc/qt6/qtquickdialogs/qml-qtquick-dialogs-folderdialog-members.html
/usr/share/doc/qt6/qtquickdialogs/qml-qtquick-dialogs-folderdialog.html
/usr/share/doc/qt6/qtquickdialogs/qml-qtquick-dialogs-fontdialog-members.html
/usr/share/doc/qt6/qtquickdialogs/qml-qtquick-dialogs-fontdialog-obsolete.html
/usr/share/doc/qt6/qtquickdialogs/qml-qtquick-dialogs-fontdialog.html
/usr/share/doc/qt6/qtquickdialogs/qml-qtquick-dialogs-messagedialog-members.html
/usr/share/doc/qt6/qtquickdialogs/qml-qtquick-dialogs-messagedialog.html
/usr/share/doc/qt6/qtquickdialogs/qtquick-dialogs-qmlmodule.html
/usr/share/doc/qt6/qtquickdialogs/qtquickdialogs-index.html
/usr/share/doc/qt6/qtquickdialogs/qtquickdialogs.index
/usr/share/doc/qt6/qtquickdialogs/qtquickdialogs.qhp
/usr/share/doc/qt6/qtquickdialogs/qtquickdialogs.qhp.sha1
/usr/share/doc/qt6/qtquickdialogs/style
/usr/share/doc/qt6/qtquickdialogs/style/offline-dark.css
/usr/share/doc/qt6/qtquickdialogs/style/offline-simple.css
/usr/share/doc/qt6/qtquickdialogs/style/offline.css
/usr/share/doc/qt6/qtquickeffectmaker/examples-manifest.xml
/usr/share/doc/qt6/qtquickeffectmaker/images
/usr/share/doc/qt6/qtquickeffectmaker/images/add-custom-node.webp
/usr/share/doc/qt6/qtquickeffectmaker/images/arrow_bc.png
/usr/share/doc/qt6/qtquickeffectmaker/images/bgrContent.png
/usr/share/doc/qt6/qtquickeffectmaker/images/blur-effect-nodes.png
/usr/share/doc/qt6/qtquickeffectmaker/images/blur-effect-step-1.webp
/usr/share/doc/qt6/qtquickeffectmaker/images/blur-effect-step-2.webp
/usr/share/doc/qt6/qtquickeffectmaker/images/blur-effect-step-3.webp
/usr/share/doc/qt6/qtquickeffectmaker/images/btn_next.png
/usr/share/doc/qt6/qtquickeffectmaker/images/btn_prev.png
/usr/share/doc/qt6/qtquickeffectmaker/images/bullet_dn.png
/usr/share/doc/qt6/qtquickeffectmaker/images/bullet_sq.png
/usr/share/doc/qt6/qtquickeffectmaker/images/effect-item-borders-icon.png
/usr/share/doc/qt6/qtquickeffectmaker/images/effect-item-padding-dialog.png
/usr/share/doc/qt6/qtquickeffectmaker/images/effect-maker-export.png
/usr/share/doc/qt6/qtquickeffectmaker/images/home.png
/usr/share/doc/qt6/qtquickeffectmaker/images/ico_note.png
/usr/share/doc/qt6/qtquickeffectmaker/images/ico_note_attention.png
/usr/share/doc/qt6/qtquickeffectmaker/images/ico_out.png
/usr/share/doc/qt6/qtquickeffectmaker/images/logo.png
/usr/share/doc/qt6/qtquickeffectmaker/images/qqem-online-installer.webp
/usr/share/doc/qt6/qtquickeffectmaker/images/qqem-start.webp
/usr/share/doc/qt6/qtquickeffectmaker/images/vert-tab.png
/usr/share/doc/qt6/qtquickeffectmaker/images/wiggly-example.png
/usr/share/doc/qt6/qtquickeffectmaker/images/wiggly-ledscreen.png
/usr/share/doc/qt6/qtquickeffectmaker/images/wiggly-qqem.png
/usr/share/doc/qt6/qtquickeffectmaker/images/wiggly-settings.png
/usr/share/doc/qt6/qtquickeffectmaker/images/wiggly-sourceitem.png
/usr/share/doc/qt6/qtquickeffectmaker/qqem-concept.html
/usr/share/doc/qt6/qtquickeffectmaker/qqem-create-first-effect.html
/usr/share/doc/qt6/qtquickeffectmaker/qqem-creating-blur-effect.html
/usr/share/doc/qt6/qtquickeffectmaker/qqem-installing.html
/usr/share/doc/qt6/qtquickeffectmaker/qqem-porting-shadertoy.html
/usr/share/doc/qt6/qtquickeffectmaker/qqem-toc.html
/usr/share/doc/qt6/qtquickeffectmaker/qqem-troubleshooting.html
/usr/share/doc/qt6/qtquickeffectmaker/qtquickeffectmaker-index.html
/usr/share/doc/qt6/qtquickeffectmaker/qtquickeffectmaker-wiggly-cmakelists-txt.html
/usr/share/doc/qt6/qtquickeffectmaker/qtquickeffectmaker-wiggly-example.html
/usr/share/doc/qt6/qtquickeffectmaker/qtquickeffectmaker-wiggly-main-cpp.html
/usr/share/doc/qt6/qtquickeffectmaker/qtquickeffectmaker-wiggly-main-qml.html
/usr/share/doc/qt6/qtquickeffectmaker/qtquickeffectmaker-wiggly-qml-qrc.html
/usr/share/doc/qt6/qtquickeffectmaker/qtquickeffectmaker-wiggly-wiggly-pro.html
/usr/share/doc/qt6/qtquickeffectmaker/qtquickeffectmaker-wiggly-wigglyeffect-wigglyeffect-qml.html
/usr/share/doc/qt6/qtquickeffectmaker/qtquickeffectmaker.index
/usr/share/doc/qt6/qtquickeffectmaker/qtquickeffectmaker.qhp
/usr/share/doc/qt6/qtquickeffectmaker/qtquickeffectmaker.qhp.sha1
/usr/share/doc/qt6/qtquickeffectmaker/quickeffectmaker-examples.html
/usr/share/doc/qt6/qtquickeffectmaker/style
/usr/share/doc/qt6/qtquickeffectmaker/style/offline-dark.css
/usr/share/doc/qt6/qtquickeffectmaker/style/offline-simple.css
/usr/share/doc/qt6/qtquickeffectmaker/style/offline.css
/usr/share/doc/qt6/qtquicktimeline/images
/usr/share/doc/qt6/qtquicktimeline/images/arrow_bc.png
/usr/share/doc/qt6/qtquicktimeline/images/bgrContent.png
/usr/share/doc/qt6/qtquicktimeline/images/btn_next.png
/usr/share/doc/qt6/qtquicktimeline/images/btn_prev.png
/usr/share/doc/qt6/qtquicktimeline/images/bullet_dn.png
/usr/share/doc/qt6/qtquicktimeline/images/bullet_sq.png
/usr/share/doc/qt6/qtquicktimeline/images/home.png
/usr/share/doc/qt6/qtquicktimeline/images/ico_note.png
/usr/share/doc/qt6/qtquicktimeline/images/ico_note_attention.png
/usr/share/doc/qt6/qtquicktimeline/images/ico_out.png
/usr/share/doc/qt6/qtquicktimeline/images/logo.png
/usr/share/doc/qt6/qtquicktimeline/images/timeline-editor.png
/usr/share/doc/qt6/qtquicktimeline/images/timeline-settings.png
/usr/share/doc/qt6/qtquicktimeline/qml-qtquick-timeline-keyframe-members.html
/usr/share/doc/qt6/qtquicktimeline/qml-qtquick-timeline-keyframe.html
/usr/share/doc/qt6/qtquicktimeline/qml-qtquick-timeline-keyframegroup-members.html
/usr/share/doc/qt6/qtquicktimeline/qml-qtquick-timeline-keyframegroup.html
/usr/share/doc/qt6/qtquicktimeline/qml-qtquick-timeline-timeline-members.html
/usr/share/doc/qt6/qtquicktimeline/qml-qtquick-timeline-timeline.html
/usr/share/doc/qt6/qtquicktimeline/qml-qtquick-timeline-timelineanimation-members.html
/usr/share/doc/qt6/qtquicktimeline/qml-qtquick-timeline-timelineanimation.html
/usr/share/doc/qt6/qtquicktimeline/qtquick-timeline-qmlmodule.html
/usr/share/doc/qt6/qtquicktimeline/qtquicktimeline-changes-qt6.html
/usr/share/doc/qt6/qtquicktimeline/qtquicktimeline-index.html
/usr/share/doc/qt6/qtquicktimeline/qtquicktimeline-overview.html
/usr/share/doc/qt6/qtquicktimeline/qtquicktimeline.index
/usr/share/doc/qt6/qtquicktimeline/qtquicktimeline.qhp
/usr/share/doc/qt6/qtquicktimeline/qtquicktimeline.qhp.sha1
/usr/share/doc/qt6/qtquicktimeline/style
/usr/share/doc/qt6/qtquicktimeline/style/offline-dark.css
/usr/share/doc/qt6/qtquicktimeline/style/offline-simple.css
/usr/share/doc/qt6/qtquicktimeline/style/offline.css
/usr/share/doc/qt6/qtremoteobjects/examples-manifest.xml
/usr/share/doc/qt6/qtremoteobjects/images
/usr/share/doc/qt6/qtremoteobjects/images/DirectConnectClientServerOutput.png
/usr/share/doc/qt6/qtremoteobjects/images/DirectConnectServerOutput.png
/usr/share/doc/qt6/qtremoteobjects/images/StandardItemTableWindow.webp
/usr/share/doc/qt6/qtremoteobjects/images/arrow_bc.png
/usr/share/doc/qt6/qtremoteobjects/images/bgrContent.png
/usr/share/doc/qt6/qtremoteobjects/images/btn_next.png
/usr/share/doc/qt6/qtremoteobjects/images/btn_prev.png
/usr/share/doc/qt6/qtremoteobjects/images/bullet_dn.png
/usr/share/doc/qt6/qtremoteobjects/images/bullet_sq.png
/usr/share/doc/qt6/qtremoteobjects/images/clientapp-example.webp
/usr/share/doc/qt6/qtremoteobjects/images/home.png
/usr/share/doc/qt6/qtremoteobjects/images/ico_note.png
/usr/share/doc/qt6/qtremoteobjects/images/ico_note_attention.png
/usr/share/doc/qt6/qtremoteobjects/images/ico_out.png
/usr/share/doc/qt6/qtremoteobjects/images/logo.png
/usr/share/doc/qt6/qtremoteobjects/images/remoteobjects-server-example.webp
/usr/share/doc/qt6/qtremoteobjects/images/simpleswitch-example.webp
/usr/share/doc/qt6/qtremoteobjects/images/ssl-example.webp
/usr/share/doc/qt6/qtremoteobjects/qabstractitemmodelreplica-members.html
/usr/share/doc/qt6/qtremoteobjects/qabstractitemmodelreplica.html
/usr/share/doc/qt6/qtremoteobjects/qml-qtremoteobjects-host-members.html
/usr/share/doc/qt6/qtremoteobjects/qml-qtremoteobjects-host.html
/usr/share/doc/qt6/qtremoteobjects/qml-qtremoteobjects-node-members.html
/usr/share/doc/qt6/qtremoteobjects/qml-qtremoteobjects-node.html
/usr/share/doc/qt6/qtremoteobjects/qml-qtremoteobjects-qtremoteobjects-members.html
/usr/share/doc/qt6/qtremoteobjects/qml-qtremoteobjects-qtremoteobjects.html
/usr/share/doc/qt6/qtremoteobjects/qml-qtremoteobjects-settingsstore-members.html
/usr/share/doc/qt6/qtremoteobjects/qml-qtremoteobjects-settingsstore.html
/usr/share/doc/qt6/qtremoteobjects/qremoteobjectabstractpersistedstore-members.html
/usr/share/doc/qt6/qtremoteobjects/qremoteobjectabstractpersistedstore.html
/usr/share/doc/qt6/qtremoteobjects/qremoteobjectdynamicreplica-members.html
/usr/share/doc/qt6/qtremoteobjects/qremoteobjectdynamicreplica.html
/usr/share/doc/qt6/qtremoteobjects/qremoteobjecthost-members.html
/usr/share/doc/qt6/qtremoteobjects/qremoteobjecthost.html
/usr/share/doc/qt6/qtremoteobjects/qremoteobjecthostbase-members.html
/usr/share/doc/qt6/qtremoteobjects/qremoteobjecthostbase.html
/usr/share/doc/qt6/qtremoteobjects/qremoteobjectnode-members.html
/usr/share/doc/qt6/qtremoteobjects/qremoteobjectnode.html
/usr/share/doc/qt6/qtremoteobjects/qremoteobjectpendingcall-members.html
/usr/share/doc/qt6/qtremoteobjects/qremoteobjectpendingcall.html
/usr/share/doc/qt6/qtremoteobjects/qremoteobjectpendingcallwatcher-members.html
/usr/share/doc/qt6/qtremoteobjects/qremoteobjectpendingcallwatcher.html
/usr/share/doc/qt6/qtremoteobjects/qremoteobjectpendingreply-members.html
/usr/share/doc/qt6/qtremoteobjects/qremoteobjectpendingreply.html
/usr/share/doc/qt6/qtremoteobjects/qremoteobjectregistry-members.html
/usr/share/doc/qt6/qtremoteobjects/qremoteobjectregistry.html
/usr/share/doc/qt6/qtremoteobjects/qremoteobjectregistryhost-members.html
/usr/share/doc/qt6/qtremoteobjects/qremoteobjectregistryhost.html
/usr/share/doc/qt6/qtremoteobjects/qremoteobjectreplica-members.html
/usr/share/doc/qt6/qtremoteobjects/qremoteobjectreplica.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-clientapp-example.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-cmake-qt-add-repc-merged.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-cmake-qt-add-repc-replicas.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-cmake-qt-add-repc-sources.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-cmake-qt-rep-from-headers.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-compatibility.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-custom-transport.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-examples.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-external-schemas.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-gettingstarted.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-index.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-interaction.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-modelviewclient-example.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-modelviewserver-example.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-module.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-node.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-qmlmodule.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-registry.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-remoteobjects-server-example.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-repc.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-replica.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-simpleswitch-example.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-source.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-ssl-example.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-troubleshooting.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects-websockets-example.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects.html
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects.index
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects.qhp
/usr/share/doc/qt6/qtremoteobjects/qtremoteobjects.qhp.sha1
/usr/share/doc/qt6/qtremoteobjects/qtroclientfactory.html
/usr/share/doc/qt6/qtremoteobjects/qtroserverfactory.html
/usr/share/doc/qt6/qtremoteobjects/remoteobjects-changes-qt6.html
/usr/share/doc/qt6/qtremoteobjects/remoteobjects-example-dynamic-replica.html
/usr/share/doc/qt6/qtremoteobjects/remoteobjects-example-registry.html
/usr/share/doc/qt6/qtremoteobjects/remoteobjects-example-static-source.html
/usr/share/doc/qt6/qtremoteobjects/style
/usr/share/doc/qt6/qtremoteobjects/style/offline-dark.css
/usr/share/doc/qt6/qtremoteobjects/style/offline-simple.css
/usr/share/doc/qt6/qtremoteobjects/style/offline.css
/usr/share/doc/qt6/qtscxml/examples-manifest.xml
/usr/share/doc/qt6/qtscxml/examples-qtscxml.html
/usr/share/doc/qt6/qtscxml/images
/usr/share/doc/qt6/qtscxml/images/arrow_bc.png
/usr/share/doc/qt6/qtscxml/images/bgrContent.png
/usr/share/doc/qt6/qtscxml/images/btn_next.png
/usr/share/doc/qt6/qtscxml/images/btn_prev.png
/usr/share/doc/qt6/qtscxml/images/bullet_dn.png
/usr/share/doc/qt6/qtscxml/images/bullet_sq.png
/usr/share/doc/qt6/qtscxml/images/calculator.png
/usr/share/doc/qt6/qtscxml/images/ftpclient-statechart.png
/usr/share/doc/qt6/qtscxml/images/home.png
/usr/share/doc/qt6/qtscxml/images/ico_note.png
/usr/share/doc/qt6/qtscxml/images/ico_note_attention.png
/usr/share/doc/qt6/qtscxml/images/ico_out.png
/usr/share/doc/qt6/qtscxml/images/invoke.png
/usr/share/doc/qt6/qtscxml/images/logo.png
/usr/share/doc/qt6/qtscxml/images/mediaplayer.png
/usr/share/doc/qt6/qtscxml/images/sudoku.png
/usr/share/doc/qt6/qtscxml/images/trafficlight.png
/usr/share/doc/qt6/qtscxml/qml-qtscxml-eventconnection-members.html
/usr/share/doc/qt6/qtscxml/qml-qtscxml-eventconnection.html
/usr/share/doc/qt6/qtscxml/qml-qtscxml-invokedservices-members.html
/usr/share/doc/qt6/qtscxml/qml-qtscxml-invokedservices.html
/usr/share/doc/qt6/qtscxml/qml-qtscxml-scxmlstatemachine-members.html
/usr/share/doc/qt6/qtscxml/qml-qtscxml-scxmlstatemachine.html
/usr/share/doc/qt6/qtscxml/qml-qtscxml-statemachineloader-members.html
/usr/share/doc/qt6/qtscxml/qml-qtscxml-statemachineloader.html
/usr/share/doc/qt6/qtscxml/qscxmlc.html
/usr/share/doc/qt6/qtscxml/qscxmlcompiler-loader-members.html
/usr/share/doc/qt6/qtscxml/qscxmlcompiler-loader.html
/usr/share/doc/qt6/qtscxml/qscxmlcompiler-members.html
/usr/share/doc/qt6/qtscxml/qscxmlcompiler.html
/usr/share/doc/qt6/qtscxml/qscxmlcppdatamodel-members.html
/usr/share/doc/qt6/qtscxml/qscxmlcppdatamodel.html
/usr/share/doc/qt6/qtscxml/qscxmldatamodel-foreachloopbody-members.html
/usr/share/doc/qt6/qtscxml/qscxmldatamodel-foreachloopbody.html
/usr/share/doc/qt6/qtscxml/qscxmldatamodel-members.html
/usr/share/doc/qt6/qtscxml/qscxmldatamodel.html
/usr/share/doc/qt6/qtscxml/qscxmldynamicscxmlservicefactory-members.html
/usr/share/doc/qt6/qtscxml/qscxmldynamicscxmlservicefactory.html
/usr/share/doc/qt6/qtscxml/qscxmlerror-members.html
/usr/share/doc/qt6/qtscxml/qscxmlerror.html
/usr/share/doc/qt6/qtscxml/qscxmlevent-members.html
/usr/share/doc/qt6/qtscxml/qscxmlevent.html
/usr/share/doc/qt6/qtscxml/qscxmlexecutablecontent-assignmentinfo-members.html
/usr/share/doc/qt6/qtscxml/qscxmlexecutablecontent-assignmentinfo.html
/usr/share/doc/qt6/qtscxml/qscxmlexecutablecontent-evaluatorinfo-members.html
/usr/share/doc/qt6/qtscxml/qscxmlexecutablecontent-evaluatorinfo.html
/usr/share/doc/qt6/qtscxml/qscxmlexecutablecontent-foreachinfo-members.html
/usr/share/doc/qt6/qtscxml/qscxmlexecutablecontent-foreachinfo.html
/usr/share/doc/qt6/qtscxml/qscxmlexecutablecontent-invokeinfo-members.html
/usr/share/doc/qt6/qtscxml/qscxmlexecutablecontent-invokeinfo.html
/usr/share/doc/qt6/qtscxml/qscxmlexecutablecontent-parameterinfo-members.html
/usr/share/doc/qt6/qtscxml/qscxmlexecutablecontent-parameterinfo.html
/usr/share/doc/qt6/qtscxml/qscxmlexecutablecontent.html
/usr/share/doc/qt6/qtscxml/qscxmlinvokableservice-members.html
/usr/share/doc/qt6/qtscxml/qscxmlinvokableservice.html
/usr/share/doc/qt6/qtscxml/qscxmlinvokableservicefactory-members.html
/usr/share/doc/qt6/qtscxml/qscxmlinvokableservicefactory.html
/usr/share/doc/qt6/qtscxml/qscxmlnulldatamodel-members.html
/usr/share/doc/qt6/qtscxml/qscxmlnulldatamodel.html
/usr/share/doc/qt6/qtscxml/qscxmlstatemachine-members.html
/usr/share/doc/qt6/qtscxml/qscxmlstatemachine.html
/usr/share/doc/qt6/qtscxml/qscxmlstaticscxmlservicefactory-members.html
/usr/share/doc/qt6/qtscxml/qscxmlstaticscxmlservicefactory.html
/usr/share/doc/qt6/qtscxml/qscxmltabledata-members.html
/usr/share/doc/qt6/qtscxml/qscxmltabledata.html
/usr/share/doc/qt6/qtscxml/qtscxml-calculator-example.html
/usr/share/doc/qt6/qtscxml/qtscxml-changes-qt6.html
/usr/share/doc/qt6/qtscxml/qtscxml-cmake-qt-add-statecharts.html
/usr/share/doc/qt6/qtscxml/qtscxml-ftpclient-example.html
/usr/share/doc/qt6/qtscxml/qtscxml-index.html
/usr/share/doc/qt6/qtscxml/qtscxml-instantiating-state-machines.html
/usr/share/doc/qt6/qtscxml/qtscxml-invoke-example.html
/usr/share/doc/qt6/qtscxml/qtscxml-mediaplayer-example.html
/usr/share/doc/qt6/qtscxml/qtscxml-module.html
/usr/share/doc/qt6/qtscxml/qtscxml-overview.html
/usr/share/doc/qt6/qtscxml/qtscxml-qmlmodule.html
/usr/share/doc/qt6/qtscxml/qtscxml-scxml-compliance.html
/usr/share/doc/qt6/qtscxml/qtscxml-sudoku-example.html
/usr/share/doc/qt6/qtscxml/qtscxml-trafficlight-qml-dynamic-example.html
/usr/share/doc/qt6/qtscxml/qtscxml-trafficlight-qml-simple-example.html
/usr/share/doc/qt6/qtscxml/qtscxml-trafficlight-qml-static-example.html
/usr/share/doc/qt6/qtscxml/qtscxml-trafficlight-widgets-dynamic-example.html
/usr/share/doc/qt6/qtscxml/qtscxml-trafficlight-widgets-static-example.html
/usr/share/doc/qt6/qtscxml/qtscxml.index
/usr/share/doc/qt6/qtscxml/qtscxml.qhp
/usr/share/doc/qt6/qtscxml/qtscxml.qhp.sha1
/usr/share/doc/qt6/qtscxml/style
/usr/share/doc/qt6/qtscxml/style/offline-dark.css
/usr/share/doc/qt6/qtscxml/style/offline-simple.css
/usr/share/doc/qt6/qtscxml/style/offline.css
/usr/share/doc/qt6/qtsensors/compatmap.html
/usr/share/doc/qt6/qtsensors/creating-a-sensor-plugin.html
/usr/share/doc/qt6/qtsensors/determining-the-default-sensor-for-a-type.html
/usr/share/doc/qt6/qtsensors/dynamic-sensor-backend-registration.html
/usr/share/doc/qt6/qtsensors/examples-manifest.xml
/usr/share/doc/qt6/qtsensors/genericbackend.html
/usr/share/doc/qt6/qtsensors/images
/usr/share/doc/qt6/qtsensors/images/arrow_bc.png
/usr/share/doc/qt6/qtsensors/images/bgrContent.png
/usr/share/doc/qt6/qtsensors/images/btn_next.png
/usr/share/doc/qt6/qtsensors/images/btn_prev.png
/usr/share/doc/qt6/qtsensors/images/bullet_dn.png
/usr/share/doc/qt6/qtsensors/images/bullet_sq.png
/usr/share/doc/qt6/qtsensors/images/home.png
/usr/share/doc/qt6/qtsensors/images/ico_note.png
/usr/share/doc/qt6/qtsensors/images/ico_note_attention.png
/usr/share/doc/qt6/qtsensors/images/ico_out.png
/usr/share/doc/qt6/qtsensors/images/logo.png
/usr/share/doc/qt6/qtsensors/images/sensors-coordinates.jpg
/usr/share/doc/qt6/qtsensors/images/sensors-coordinates2.jpg
/usr/share/doc/qt6/qtsensors/images/sensors-coordinates3.jpg
/usr/share/doc/qt6/qtsensors/images/sensors-dynamic.png
/usr/share/doc/qt6/qtsensors/images/sensors-geo-vs-raw-magnetism.jpg
/usr/share/doc/qt6/qtsensors/images/sensors-orientation.jpg
/usr/share/doc/qt6/qtsensors/images/sensors-overview.png
/usr/share/doc/qt6/qtsensors/images/sensors-rotation-anim.gif
/usr/share/doc/qt6/qtsensors/images/sensors-rotation.jpg
/usr/share/doc/qt6/qtsensors/images/sensors-rotation2.jpg
/usr/share/doc/qt6/qtsensors/images/sensors-rotation3.jpg
/usr/share/doc/qt6/qtsensors/images/sensors-sides.jpg
/usr/share/doc/qt6/qtsensors/images/sensors-sides2.jpg
/usr/share/doc/qt6/qtsensors/images/sensors-static.png
/usr/share/doc/qt6/qtsensors/images/sensorsshowcase-gyroscope.webp
/usr/share/doc/qt6/qtsensors/images/sensorsshowcase-mainview.webp
/usr/share/doc/qt6/qtsensors/qaccelerometer-members.html
/usr/share/doc/qt6/qtsensors/qaccelerometer.html
/usr/share/doc/qt6/qtsensors/qaccelerometerfilter-members.html
/usr/share/doc/qt6/qtsensors/qaccelerometerfilter.html
/usr/share/doc/qt6/qtsensors/qaccelerometerreading-members.html
/usr/share/doc/qt6/qtsensors/qaccelerometerreading.html
/usr/share/doc/qt6/qtsensors/qambientlightfilter-members.html
/usr/share/doc/qt6/qtsensors/qambientlightfilter.html
/usr/share/doc/qt6/qtsensors/qambientlightreading-members.html
/usr/share/doc/qt6/qtsensors/qambientlightreading.html
/usr/share/doc/qt6/qtsensors/qambientlightsensor-members.html
/usr/share/doc/qt6/qtsensors/qambientlightsensor.html
/usr/share/doc/qt6/qtsensors/qambienttemperaturefilter-members.html
/usr/share/doc/qt6/qtsensors/qambienttemperaturefilter.html
/usr/share/doc/qt6/qtsensors/qambienttemperaturereading-members.html
/usr/share/doc/qt6/qtsensors/qambienttemperaturereading.html
/usr/share/doc/qt6/qtsensors/qambienttemperaturesensor-members.html
/usr/share/doc/qt6/qtsensors/qambienttemperaturesensor.html
/usr/share/doc/qt6/qtsensors/qcompass-members.html
/usr/share/doc/qt6/qtsensors/qcompass.html
/usr/share/doc/qt6/qtsensors/qcompassfilter-members.html
/usr/share/doc/qt6/qtsensors/qcompassfilter.html
/usr/share/doc/qt6/qtsensors/qcompassreading-members.html
/usr/share/doc/qt6/qtsensors/qcompassreading.html
/usr/share/doc/qt6/qtsensors/qgyroscope-members.html
/usr/share/doc/qt6/qtsensors/qgyroscope.html
/usr/share/doc/qt6/qtsensors/qgyroscopefilter-members.html
/usr/share/doc/qt6/qtsensors/qgyroscopefilter.html
/usr/share/doc/qt6/qtsensors/qgyroscopereading-members.html
/usr/share/doc/qt6/qtsensors/qgyroscopereading.html
/usr/share/doc/qt6/qtsensors/qhumidityfilter-members.html
/usr/share/doc/qt6/qtsensors/qhumidityfilter.html
/usr/share/doc/qt6/qtsensors/qhumidityreading-members.html
/usr/share/doc/qt6/qtsensors/qhumidityreading.html
/usr/share/doc/qt6/qtsensors/qhumiditysensor-members.html
/usr/share/doc/qt6/qtsensors/qhumiditysensor.html
/usr/share/doc/qt6/qtsensors/qlightfilter-members.html
/usr/share/doc/qt6/qtsensors/qlightfilter.html
/usr/share/doc/qt6/qtsensors/qlightreading-members.html
/usr/share/doc/qt6/qtsensors/qlightreading.html
/usr/share/doc/qt6/qtsensors/qlightsensor-members.html
/usr/share/doc/qt6/qtsensors/qlightsensor.html
/usr/share/doc/qt6/qtsensors/qmagnetometer-members.html
/usr/share/doc/qt6/qtsensors/qmagnetometer.html
/usr/share/doc/qt6/qtsensors/qmagnetometerfilter-members.html
/usr/share/doc/qt6/qtsensors/qmagnetometerfilter.html
/usr/share/doc/qt6/qtsensors/qmagnetometerreading-members.html
/usr/share/doc/qt6/qtsensors/qmagnetometerreading.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-accelerometer-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-accelerometer.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-accelerometerreading-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-accelerometerreading.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-ambientlightreading-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-ambientlightreading.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-ambientlightsensor-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-ambientlightsensor.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-ambienttemperaturereading-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-ambienttemperaturereading.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-ambienttemperaturesensor-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-ambienttemperaturesensor.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-compass-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-compass.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-compassreading-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-compassreading.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-gyroscope-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-gyroscope.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-gyroscopereading-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-gyroscopereading.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-humidityreading-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-humidityreading.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-humiditysensor-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-humiditysensor.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-lightreading-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-lightreading.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-lightsensor-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-lightsensor.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-magnetometer-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-magnetometer.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-magnetometerreading-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-magnetometerreading.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-orientationreading-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-orientationreading.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-orientationsensor-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-orientationsensor.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-pressurereading-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-pressurereading.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-pressuresensor-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-pressuresensor.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-proximityreading-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-proximityreading.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-proximitysensor-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-proximitysensor.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-qmlsensors-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-qmlsensors.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-rotationreading-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-rotationreading.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-rotationsensor-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-rotationsensor.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-sensor-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-sensor.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-sensorreading-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-sensorreading.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-tiltreading-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-tiltreading.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-tiltsensor-members.html
/usr/share/doc/qt6/qtsensors/qml-qtsensors-tiltsensor.html
/usr/share/doc/qt6/qtsensors/qorientationfilter-members.html
/usr/share/doc/qt6/qtsensors/qorientationfilter.html
/usr/share/doc/qt6/qtsensors/qorientationreading-members.html
/usr/share/doc/qt6/qtsensors/qorientationreading.html
/usr/share/doc/qt6/qtsensors/qorientationsensor-members.html
/usr/share/doc/qt6/qtsensors/qorientationsensor.html
/usr/share/doc/qt6/qtsensors/qoutputrange-members.html
/usr/share/doc/qt6/qtsensors/qoutputrange.html
/usr/share/doc/qt6/qtsensors/qpressurefilter-members.html
/usr/share/doc/qt6/qtsensors/qpressurefilter.html
/usr/share/doc/qt6/qtsensors/qpressurereading-members.html
/usr/share/doc/qt6/qtsensors/qpressurereading.html
/usr/share/doc/qt6/qtsensors/qpressuresensor-members.html
/usr/share/doc/qt6/qtsensors/qpressuresensor.html
/usr/share/doc/qt6/qtsensors/qproximityfilter-members.html
/usr/share/doc/qt6/qtsensors/qproximityfilter.html
/usr/share/doc/qt6/qtsensors/qproximityreading-members.html
/usr/share/doc/qt6/qtsensors/qproximityreading.html
/usr/share/doc/qt6/qtsensors/qproximitysensor-members.html
/usr/share/doc/qt6/qtsensors/qproximitysensor.html
/usr/share/doc/qt6/qtsensors/qrotationfilter-members.html
/usr/share/doc/qt6/qtsensors/qrotationfilter.html
/usr/share/doc/qt6/qtsensors/qrotationreading-members.html
/usr/share/doc/qt6/qtsensors/qrotationreading.html
/usr/share/doc/qt6/qtsensors/qrotationsensor-members.html
/usr/share/doc/qt6/qtsensors/qrotationsensor.html
/usr/share/doc/qt6/qtsensors/qsensor-members.html
/usr/share/doc/qt6/qtsensors/qsensor.html
/usr/share/doc/qt6/qtsensors/qsensorbackend-members.html
/usr/share/doc/qt6/qtsensors/qsensorbackend.html
/usr/share/doc/qt6/qtsensors/qsensorbackendfactory-members.html
/usr/share/doc/qt6/qtsensors/qsensorbackendfactory.html
/usr/share/doc/qt6/qtsensors/qsensorchangesinterface-members.html
/usr/share/doc/qt6/qtsensors/qsensorchangesinterface.html
/usr/share/doc/qt6/qtsensors/qsensorfilter-members.html
/usr/share/doc/qt6/qtsensors/qsensorfilter.html
/usr/share/doc/qt6/qtsensors/qsensormanager-members.html
/usr/share/doc/qt6/qtsensors/qsensormanager.html
/usr/share/doc/qt6/qtsensors/qsensorplugininterface-members.html
/usr/share/doc/qt6/qtsensors/qsensorplugininterface.html
/usr/share/doc/qt6/qtsensors/qsensorreading-members.html
/usr/share/doc/qt6/qtsensors/qsensorreading.html
/usr/share/doc/qt6/qtsensors/qtiltfilter-members.html
/usr/share/doc/qt6/qtsensors/qtiltfilter.html
/usr/share/doc/qt6/qtsensors/qtiltreading-members.html
/usr/share/doc/qt6/qtsensors/qtiltreading.html
/usr/share/doc/qt6/qtsensors/qtiltsensor-members.html
/usr/share/doc/qt6/qtsensors/qtiltsensor.html
/usr/share/doc/qt6/qtsensors/qtsensors-changes-qt6.html
/usr/share/doc/qt6/qtsensors/qtsensors-cpp.html
/usr/share/doc/qt6/qtsensors/qtsensors-examples.html
/usr/share/doc/qt6/qtsensors/qtsensors-index.html
/usr/share/doc/qt6/qtsensors/qtsensors-module.html
/usr/share/doc/qt6/qtsensors/qtsensors-qmlmodule.html
/usr/share/doc/qt6/qtsensors/qtsensors-sensorsshowcase-example.html
/usr/share/doc/qt6/qtsensors/qtsensors-tutorial.html
/usr/share/doc/qt6/qtsensors/qtsensors.index
/usr/share/doc/qt6/qtsensors/qtsensors.qhp
/usr/share/doc/qt6/qtsensors/qtsensors.qhp.sha1
/usr/share/doc/qt6/qtsensors/senorfwbackend.html
/usr/share/doc/qt6/qtsensors/sensors-backend-topics.html
/usr/share/doc/qt6/qtsensors/style
/usr/share/doc/qt6/qtsensors/style/offline-dark.css
/usr/share/doc/qt6/qtsensors/style/offline-simple.css
/usr/share/doc/qt6/qtsensors/style/offline.css
/usr/share/doc/qt6/qtserialbus/examples-manifest.xml
/usr/share/doc/qt6/qtserialbus/images
/usr/share/doc/qt6/qtserialbus/images/arrow_bc.png
/usr/share/doc/qt6/qtserialbus/images/bgrContent.png
/usr/share/doc/qt6/qtserialbus/images/btn_next.png
/usr/share/doc/qt6/qtserialbus/images/btn_prev.png
/usr/share/doc/qt6/qtserialbus/images/bullet_dn.png
/usr/share/doc/qt6/qtserialbus/images/bullet_sq.png
/usr/share/doc/qt6/qtserialbus/images/can-example.png
/usr/share/doc/qt6/qtserialbus/images/canbus_signals_be.png
/usr/share/doc/qt6/qtserialbus/images/canbus_signals_le.png
/usr/share/doc/qt6/qtserialbus/images/custom.png
/usr/share/doc/qt6/qtserialbus/images/home.png
/usr/share/doc/qt6/qtserialbus/images/ico_note.png
/usr/share/doc/qt6/qtserialbus/images/ico_note_attention.png
/usr/share/doc/qt6/qtserialbus/images/ico_out.png
/usr/share/doc/qt6/qtserialbus/images/logo.png
/usr/share/doc/qt6/qtserialbus/images/modbusclient.png
/usr/share/doc/qt6/qtserialbus/images/modbusserver.png
/usr/share/doc/qt6/qtserialbus/qcanbus-members.html
/usr/share/doc/qt6/qtserialbus/qcanbus.html
/usr/share/doc/qt6/qtserialbus/qcanbusdevice-filter-members.html
/usr/share/doc/qt6/qtserialbus/qcanbusdevice-filter.html
/usr/share/doc/qt6/qtserialbus/qcanbusdevice-members.html
/usr/share/doc/qt6/qtserialbus/qcanbusdevice.html
/usr/share/doc/qt6/qtserialbus/qcanbusdeviceinfo-members.html
/usr/share/doc/qt6/qtserialbus/qcanbusdeviceinfo.html
/usr/share/doc/qt6/qtserialbus/qcanbusfactory-members.html
/usr/share/doc/qt6/qtserialbus/qcanbusfactory.html
/usr/share/doc/qt6/qtserialbus/qcanbusframe-members.html
/usr/share/doc/qt6/qtserialbus/qcanbusframe-timestamp-members.html
/usr/share/doc/qt6/qtserialbus/qcanbusframe-timestamp.html
/usr/share/doc/qt6/qtserialbus/qcanbusframe.html
/usr/share/doc/qt6/qtserialbus/qcandbcfileparser-members.html
/usr/share/doc/qt6/qtserialbus/qcandbcfileparser.html
/usr/share/doc/qt6/qtserialbus/qcanframeprocessor-members.html
/usr/share/doc/qt6/qtserialbus/qcanframeprocessor-parseresult-members.html
/usr/share/doc/qt6/qtserialbus/qcanframeprocessor-parseresult.html
/usr/share/doc/qt6/qtserialbus/qcanframeprocessor.html
/usr/share/doc/qt6/qtserialbus/qcanmessagedescription-members.html
/usr/share/doc/qt6/qtserialbus/qcanmessagedescription.html
/usr/share/doc/qt6/qtserialbus/qcansignaldescription-members.html
/usr/share/doc/qt6/qtserialbus/qcansignaldescription-multiplexvaluerange-members.html
/usr/share/doc/qt6/qtserialbus/qcansignaldescription-multiplexvaluerange.html
/usr/share/doc/qt6/qtserialbus/qcansignaldescription.html
/usr/share/doc/qt6/qtserialbus/qcanuniqueiddescription-members.html
/usr/share/doc/qt6/qtserialbus/qcanuniqueiddescription.html
/usr/share/doc/qt6/qtserialbus/qmodbusclient-members.html
/usr/share/doc/qt6/qtserialbus/qmodbusclient.html
/usr/share/doc/qt6/qtserialbus/qmodbusdataunit-members.html
/usr/share/doc/qt6/qtserialbus/qmodbusdataunit.html
/usr/share/doc/qt6/qtserialbus/qmodbusdevice-members.html
/usr/share/doc/qt6/qtserialbus/qmodbusdevice.html
/usr/share/doc/qt6/qtserialbus/qmodbusdeviceidentification-members.html
/usr/share/doc/qt6/qtserialbus/qmodbusdeviceidentification.html
/usr/share/doc/qt6/qtserialbus/qmodbusexceptionresponse-members.html
/usr/share/doc/qt6/qtserialbus/qmodbusexceptionresponse.html
/usr/share/doc/qt6/qtserialbus/qmodbuspdu-members.html
/usr/share/doc/qt6/qtserialbus/qmodbuspdu.html
/usr/share/doc/qt6/qtserialbus/qmodbusreply-members.html
/usr/share/doc/qt6/qtserialbus/qmodbusreply.html
/usr/share/doc/qt6/qtserialbus/qmodbusrequest-members.html
/usr/share/doc/qt6/qtserialbus/qmodbusrequest.html
/usr/share/doc/qt6/qtserialbus/qmodbusresponse-members.html
/usr/share/doc/qt6/qtserialbus/qmodbusresponse.html
/usr/share/doc/qt6/qtserialbus/qmodbusrtuserialclient-members.html
/usr/share/doc/qt6/qtserialbus/qmodbusrtuserialclient.html
/usr/share/doc/qt6/qtserialbus/qmodbusrtuserialserver-members.html
/usr/share/doc/qt6/qtserialbus/qmodbusrtuserialserver.html
/usr/share/doc/qt6/qtserialbus/qmodbusserver-members.html
/usr/share/doc/qt6/qtserialbus/qmodbusserver.html
/usr/share/doc/qt6/qtserialbus/qmodbustcpclient-members.html
/usr/share/doc/qt6/qtserialbus/qmodbustcpclient.html
/usr/share/doc/qt6/qtserialbus/qmodbustcpconnectionobserver-members.html
/usr/share/doc/qt6/qtserialbus/qmodbustcpconnectionobserver.html
/usr/share/doc/qt6/qtserialbus/qmodbustcpserver-members.html
/usr/share/doc/qt6/qtserialbus/qmodbustcpserver.html
/usr/share/doc/qt6/qtserialbus/qtcanbus-backends.html
/usr/share/doc/qt6/qtserialbus/qtcanbus.html
/usr/share/doc/qt6/qtserialbus/qtmodbus-backends.html
/usr/share/doc/qt6/qtserialbus/qtserialbus-can-example.html
/usr/share/doc/qt6/qtserialbus/qtserialbus-changes-qt6.html
/usr/share/doc/qt6/qtserialbus/qtserialbus-examples.html
/usr/share/doc/qt6/qtserialbus/qtserialbus-index.html
/usr/share/doc/qt6/qtserialbus/qtserialbus-modbus-client-example.html
/usr/share/doc/qt6/qtserialbus/qtserialbus-modbus-custom-example.html
/usr/share/doc/qt6/qtserialbus/qtserialbus-modbus-server-example.html
/usr/share/doc/qt6/qtserialbus/qtserialbus-module.html
/usr/share/doc/qt6/qtserialbus/qtserialbus-passthrucan-overview.html
/usr/share/doc/qt6/qtserialbus/qtserialbus-peakcan-overview.html
/usr/share/doc/qt6/qtserialbus/qtserialbus-socketcan-overview.html
/usr/share/doc/qt6/qtserialbus/qtserialbus-systeccan-overview.html
/usr/share/doc/qt6/qtserialbus/qtserialbus-tinycan-overview.html
/usr/share/doc/qt6/qtserialbus/qtserialbus-vectorcan-overview.html
/usr/share/doc/qt6/qtserialbus/qtserialbus-virtualcan-overview.html
/usr/share/doc/qt6/qtserialbus/qtserialbus.index
/usr/share/doc/qt6/qtserialbus/qtserialbus.qhp
/usr/share/doc/qt6/qtserialbus/qtserialbus.qhp.sha1
/usr/share/doc/qt6/qtserialbus/style
/usr/share/doc/qt6/qtserialbus/style/offline-dark.css
/usr/share/doc/qt6/qtserialbus/style/offline-simple.css
/usr/share/doc/qt6/qtserialbus/style/offline.css
/usr/share/doc/qt6/qtserialport/examples-manifest.xml
/usr/share/doc/qt6/qtserialport/images
/usr/share/doc/qt6/qtserialport/images/arrow_bc.png
/usr/share/doc/qt6/qtserialport/images/bgrContent.png
/usr/share/doc/qt6/qtserialport/images/blockingreceiver-example.png
/usr/share/doc/qt6/qtserialport/images/blockingsender-example.png
/usr/share/doc/qt6/qtserialport/images/btn_next.png
/usr/share/doc/qt6/qtserialport/images/btn_prev.png
/usr/share/doc/qt6/qtserialport/images/bullet_dn.png
/usr/share/doc/qt6/qtserialport/images/bullet_sq.png
/usr/share/doc/qt6/qtserialport/images/home.png
/usr/share/doc/qt6/qtserialport/images/ico_note.png
/usr/share/doc/qt6/qtserialport/images/ico_note_attention.png
/usr/share/doc/qt6/qtserialport/images/ico_out.png
/usr/share/doc/qt6/qtserialport/images/logo.png
/usr/share/doc/qt6/qtserialport/images/terminal-example.png
/usr/share/doc/qt6/qtserialport/qserialport-members.html
/usr/share/doc/qt6/qtserialport/qserialport.html
/usr/share/doc/qt6/qtserialport/qserialportinfo-members.html
/usr/share/doc/qt6/qtserialport/qserialportinfo.html
/usr/share/doc/qt6/qtserialport/qtserialport-blockingreceiver-example.html
/usr/share/doc/qt6/qtserialport/qtserialport-blockingsender-example.html
/usr/share/doc/qt6/qtserialport/qtserialport-changes-qt6.html
/usr/share/doc/qt6/qtserialport/qtserialport-examples.html
/usr/share/doc/qt6/qtserialport/qtserialport-index.html
/usr/share/doc/qt6/qtserialport/qtserialport-module.html
/usr/share/doc/qt6/qtserialport/qtserialport-terminal-example.html
/usr/share/doc/qt6/qtserialport/qtserialport.index
/usr/share/doc/qt6/qtserialport/qtserialport.qhp
/usr/share/doc/qt6/qtserialport/qtserialport.qhp.sha1
/usr/share/doc/qt6/qtserialport/style
/usr/share/doc/qt6/qtserialport/style/offline-dark.css
/usr/share/doc/qt6/qtserialport/style/offline-simple.css
/usr/share/doc/qt6/qtserialport/style/offline.css
/usr/share/doc/qt6/qtshadertools/images
/usr/share/doc/qt6/qtshadertools/images/arrow_bc.png
/usr/share/doc/qt6/qtshadertools/images/bgrContent.png
/usr/share/doc/qt6/qtshadertools/images/btn_next.png
/usr/share/doc/qt6/qtshadertools/images/btn_prev.png
/usr/share/doc/qt6/qtshadertools/images/bullet_dn.png
/usr/share/doc/qt6/qtshadertools/images/bullet_sq.png
/usr/share/doc/qt6/qtshadertools/images/home.png
/usr/share/doc/qt6/qtshadertools/images/ico_note.png
/usr/share/doc/qt6/qtshadertools/images/ico_note_attention.png
/usr/share/doc/qt6/qtshadertools/images/ico_out.png
/usr/share/doc/qt6/qtshadertools/images/logo.png
/usr/share/doc/qt6/qtshadertools/images/shaderconditioning.png
/usr/share/doc/qt6/qtshadertools/qshaderbaker-members.html
/usr/share/doc/qt6/qtshadertools/qshaderbaker.html
/usr/share/doc/qt6/qtshadertools/qtshadertools-attribution-glslang.html
/usr/share/doc/qt6/qtshadertools/qtshadertools-attribution-spirvcross.html
/usr/share/doc/qt6/qtshadertools/qtshadertools-build.html
/usr/share/doc/qt6/qtshadertools/qtshadertools-index.html
/usr/share/doc/qt6/qtshadertools/qtshadertools-overview.html
/usr/share/doc/qt6/qtshadertools/qtshadertools-qsb.html
/usr/share/doc/qt6/qtshadertools/qtshadertools.index
/usr/share/doc/qt6/qtshadertools/qtshadertools.qhp
/usr/share/doc/qt6/qtshadertools/qtshadertools.qhp.sha1
/usr/share/doc/qt6/qtshadertools/style
/usr/share/doc/qt6/qtshadertools/style/offline-dark.css
/usr/share/doc/qt6/qtshadertools/style/offline-simple.css
/usr/share/doc/qt6/qtshadertools/style/offline.css
/usr/share/doc/qt6/qtspatialaudio/examples-manifest.xml
/usr/share/doc/qt6/qtspatialaudio/images
/usr/share/doc/qt6/qtspatialaudio/images/arrow_bc.png
/usr/share/doc/qt6/qtspatialaudio/images/audiopanning-example.png
/usr/share/doc/qt6/qtspatialaudio/images/bgrContent.png
/usr/share/doc/qt6/qtspatialaudio/images/btn_next.png
/usr/share/doc/qt6/qtspatialaudio/images/btn_prev.png
/usr/share/doc/qt6/qtspatialaudio/images/bullet_dn.png
/usr/share/doc/qt6/qtspatialaudio/images/bullet_sq.png
/usr/share/doc/qt6/qtspatialaudio/images/home.png
/usr/share/doc/qt6/qtspatialaudio/images/ico_note.png
/usr/share/doc/qt6/qtspatialaudio/images/ico_note_attention.png
/usr/share/doc/qt6/qtspatialaudio/images/ico_out.png
/usr/share/doc/qt6/qtspatialaudio/images/logo.png
/usr/share/doc/qt6/qtspatialaudio/qambientsound-members.html
/usr/share/doc/qt6/qtspatialaudio/qambientsound.html
/usr/share/doc/qt6/qtspatialaudio/qaudioengine-members.html
/usr/share/doc/qt6/qtspatialaudio/qaudioengine.html
/usr/share/doc/qt6/qtspatialaudio/qaudiolistener-members.html
/usr/share/doc/qt6/qtspatialaudio/qaudiolistener.html
/usr/share/doc/qt6/qtspatialaudio/qaudioroom-members.html
/usr/share/doc/qt6/qtspatialaudio/qaudioroom.html
/usr/share/doc/qt6/qtspatialaudio/qml-qtquick3d-spatialaudio-ambientsound-members.html
/usr/share/doc/qt6/qtspatialaudio/qml-qtquick3d-spatialaudio-ambientsound.html
/usr/share/doc/qt6/qtspatialaudio/qml-qtquick3d-spatialaudio-audioengine-members.html
/usr/share/doc/qt6/qtspatialaudio/qml-qtquick3d-spatialaudio-audioengine.html
/usr/share/doc/qt6/qtspatialaudio/qml-qtquick3d-spatialaudio-audiolistener-members.html
/usr/share/doc/qt6/qtspatialaudio/qml-qtquick3d-spatialaudio-audiolistener.html
/usr/share/doc/qt6/qtspatialaudio/qml-qtquick3d-spatialaudio-audioroom-members.html
/usr/share/doc/qt6/qtspatialaudio/qml-qtquick3d-spatialaudio-audioroom.html
/usr/share/doc/qt6/qtspatialaudio/qml-qtquick3d-spatialaudio-spatialsound-members.html
/usr/share/doc/qt6/qtspatialaudio/qml-qtquick3d-spatialaudio-spatialsound.html
/usr/share/doc/qt6/qtspatialaudio/qspatialsound-members.html
/usr/share/doc/qt6/qtspatialaudio/qspatialsound.html
/usr/share/doc/qt6/qtspatialaudio/qtquick3d-audio-qmlmodule.html
/usr/share/doc/qt6/qtspatialaudio/qtquick3d-spatialaudio-qmlmodule.html
/usr/share/doc/qt6/qtspatialaudio/qtspatialaudio-attribution-eigen.html
/usr/share/doc/qt6/qtspatialaudio/qtspatialaudio-attribution-pfft.html
/usr/share/doc/qt6/qtspatialaudio/qtspatialaudio-attribution-resonance-audio.html
/usr/share/doc/qt6/qtspatialaudio/qtspatialaudio-audiopanning-audiopanning-pro.html
/usr/share/doc/qt6/qtspatialaudio/qtspatialaudio-audiopanning-cmakelists-txt.html
/usr/share/doc/qt6/qtspatialaudio/qtspatialaudio-audiopanning-example.html
/usr/share/doc/qt6/qtspatialaudio/qtspatialaudio-audiopanning-main-cpp.html
/usr/share/doc/qt6/qtspatialaudio/qtspatialaudio-index.html
/usr/share/doc/qt6/qtspatialaudio/qtspatialaudio-module.html
/usr/share/doc/qt6/qtspatialaudio/qtspatialaudio-modules.html
/usr/share/doc/qt6/qtspatialaudio/qtspatialaudio.index
/usr/share/doc/qt6/qtspatialaudio/qtspatialaudio.qhp
/usr/share/doc/qt6/qtspatialaudio/qtspatialaudio.qhp.sha1
/usr/share/doc/qt6/qtspatialaudio/spatialaudio-examples.html
/usr/share/doc/qt6/qtspatialaudio/spatialaudiooverview.html
/usr/share/doc/qt6/qtspatialaudio/style
/usr/share/doc/qt6/qtspatialaudio/style/offline-dark.css
/usr/share/doc/qt6/qtspatialaudio/style/offline-simple.css
/usr/share/doc/qt6/qtspatialaudio/style/offline.css
/usr/share/doc/qt6/qtsql/database.html
/usr/share/doc/qt6/qtsql/examples-manifest.xml
/usr/share/doc/qt6/qtsql/images
/usr/share/doc/qt6/qtsql/images/arrow_bc.png
/usr/share/doc/qt6/qtsql/images/bgrContent.png
/usr/share/doc/qt6/qtsql/images/books-demo.png
/usr/share/doc/qt6/qtsql/images/btn_next.png
/usr/share/doc/qt6/qtsql/images/btn_prev.png
/usr/share/doc/qt6/qtsql/images/bullet_dn.png
/usr/share/doc/qt6/qtsql/images/bullet_sq.png
/usr/share/doc/qt6/qtsql/images/cachedtable-example.png
/usr/share/doc/qt6/qtsql/images/drilldown-example.png
/usr/share/doc/qt6/qtsql/images/foreignkeys.png
/usr/share/doc/qt6/qtsql/images/home.png
/usr/share/doc/qt6/qtsql/images/ico_note.png
/usr/share/doc/qt6/qtsql/images/ico_note_attention.png
/usr/share/doc/qt6/qtsql/images/ico_out.png
/usr/share/doc/qt6/qtsql/images/insertrowinmodelview.png
/usr/share/doc/qt6/qtsql/images/logo.png
/usr/share/doc/qt6/qtsql/images/masterdetail-example.png
/usr/share/doc/qt6/qtsql/images/noforeignkeys.png
/usr/share/doc/qt6/qtsql/images/qdatawidgetmapper-simple.png
/usr/share/doc/qt6/qtsql/images/querymodel-example.png
/usr/share/doc/qt6/qtsql/images/relationaltable.png
/usr/share/doc/qt6/qtsql/images/relationaltablemodel-example.png
/usr/share/doc/qt6/qtsql/images/sql-widget-mapper.png
/usr/share/doc/qt6/qtsql/images/sqlbrowser-demo.png
/usr/share/doc/qt6/qtsql/images/tablemodel-example.png
/usr/share/doc/qt6/qtsql/images/widgetmapper-sql-mapping-table.png
/usr/share/doc/qt6/qtsql/images/widgetmapper-sql-mapping.png
/usr/share/doc/qt6/qtsql/qsql.html
/usr/share/doc/qt6/qtsql/qsqldatabase-members.html
/usr/share/doc/qt6/qtsql/qsqldatabase-obsolete.html
/usr/share/doc/qt6/qtsql/qsqldatabase.html
/usr/share/doc/qt6/qtsql/qsqldriver-members.html
/usr/share/doc/qt6/qtsql/qsqldriver.html
/usr/share/doc/qt6/qtsql/qsqldrivercreator-members.html
/usr/share/doc/qt6/qtsql/qsqldrivercreator.html
/usr/share/doc/qt6/qtsql/qsqldrivercreatorbase-members.html
/usr/share/doc/qt6/qtsql/qsqldrivercreatorbase.html
/usr/share/doc/qt6/qtsql/qsqldriverplugin-members.html
/usr/share/doc/qt6/qtsql/qsqldriverplugin.html
/usr/share/doc/qt6/qtsql/qsqlerror-members.html
/usr/share/doc/qt6/qtsql/qsqlerror.html
/usr/share/doc/qt6/qtsql/qsqlfield-members.html
/usr/share/doc/qt6/qtsql/qsqlfield-obsolete.html
/usr/share/doc/qt6/qtsql/qsqlfield.html
/usr/share/doc/qt6/qtsql/qsqlindex-members.html
/usr/share/doc/qt6/qtsql/qsqlindex.html
/usr/share/doc/qt6/qtsql/qsqlquery-members.html
/usr/share/doc/qt6/qtsql/qsqlquery-obsolete.html
/usr/share/doc/qt6/qtsql/qsqlquery.html
/usr/share/doc/qt6/qtsql/qsqlquerymodel-members.html
/usr/share/doc/qt6/qtsql/qsqlquerymodel-obsolete.html
/usr/share/doc/qt6/qtsql/qsqlquerymodel.html
/usr/share/doc/qt6/qtsql/qsqlrecord-members.html
/usr/share/doc/qt6/qtsql/qsqlrecord.html
/usr/share/doc/qt6/qtsql/qsqlrelation-members.html
/usr/share/doc/qt6/qtsql/qsqlrelation.html
/usr/share/doc/qt6/qtsql/qsqlrelationaldelegate-members.html
/usr/share/doc/qt6/qtsql/qsqlrelationaldelegate.html
/usr/share/doc/qt6/qtsql/qsqlrelationaltablemodel-members.html
/usr/share/doc/qt6/qtsql/qsqlrelationaltablemodel.html
/usr/share/doc/qt6/qtsql/qsqlresult-members.html
/usr/share/doc/qt6/qtsql/qsqlresult.html
/usr/share/doc/qt6/qtsql/qsqltablemodel-members.html
/usr/share/doc/qt6/qtsql/qsqltablemodel.html
/usr/share/doc/qt6/qtsql/qtsql-attribution-sqlite.html
/usr/share/doc/qt6/qtsql/qtsql-books-example.html
/usr/share/doc/qt6/qtsql/qtsql-cachedtable-example.html
/usr/share/doc/qt6/qtsql/qtsql-changes-qt6.html
/usr/share/doc/qt6/qtsql/qtsql-drilldown-example.html
/usr/share/doc/qt6/qtsql/qtsql-index.html
/usr/share/doc/qt6/qtsql/qtsql-masterdetail-example.html
/usr/share/doc/qt6/qtsql/qtsql-module.html
/usr/share/doc/qt6/qtsql/qtsql-querymodel-example.html
/usr/share/doc/qt6/qtsql/qtsql-relationaltablemodel-example.html
/usr/share/doc/qt6/qtsql/qtsql-sqlbrowser-example.html
/usr/share/doc/qt6/qtsql/qtsql-sqlwidgetmapper-example.html
/usr/share/doc/qt6/qtsql/qtsql-tablemodel-example.html
/usr/share/doc/qt6/qtsql/qtsql.index
/usr/share/doc/qt6/qtsql/qtsql.qhp
/usr/share/doc/qt6/qtsql/qtsql.qhp.sha1
/usr/share/doc/qt6/qtsql/sql-connecting.html
/usr/share/doc/qt6/qtsql/sql-driver.html
/usr/share/doc/qt6/qtsql/sql-forms.html
/usr/share/doc/qt6/qtsql/sql-model.html
/usr/share/doc/qt6/qtsql/sql-presenting.html
/usr/share/doc/qt6/qtsql/sql-programming.html
/usr/share/doc/qt6/qtsql/sql-sqlstatements.html
/usr/share/doc/qt6/qtsql/sql-types.html
/usr/share/doc/qt6/qtsql/style
/usr/share/doc/qt6/qtsql/style/offline-dark.css
/usr/share/doc/qt6/qtsql/style/offline-simple.css
/usr/share/doc/qt6/qtsql/style/offline.css
/usr/share/doc/qt6/qtstatemachine/examples-manifest.xml
/usr/share/doc/qt6/qtstatemachine/examples-qtstatemachine.html
/usr/share/doc/qt6/qtstatemachine/images
/usr/share/doc/qt6/qtstatemachine/images/arrow_bc.png
/usr/share/doc/qt6/qtstatemachine/images/bgrContent.png
/usr/share/doc/qt6/qtstatemachine/images/btn_next.png
/usr/share/doc/qt6/qtstatemachine/images/btn_prev.png
/usr/share/doc/qt6/qtstatemachine/images/bullet_dn.png
/usr/share/doc/qt6/qtstatemachine/images/bullet_sq.png
/usr/share/doc/qt6/qtstatemachine/images/home.png
/usr/share/doc/qt6/qtstatemachine/images/ico_note.png
/usr/share/doc/qt6/qtstatemachine/images/ico_note_attention.png
/usr/share/doc/qt6/qtstatemachine/images/ico_out.png
/usr/share/doc/qt6/qtstatemachine/images/logo.png
/usr/share/doc/qt6/qtstatemachine/images/move-blocks-chart.png
/usr/share/doc/qt6/qtstatemachine/images/moveblocks-example.png
/usr/share/doc/qt6/qtstatemachine/images/pingpong-example.png
/usr/share/doc/qt6/qtstatemachine/images/rogue-example.png
/usr/share/doc/qt6/qtstatemachine/images/rogue-statechart.png
/usr/share/doc/qt6/qtstatemachine/images/statemachine-button-history.png
/usr/share/doc/qt6/qtstatemachine/images/statemachine-button-nested.png
/usr/share/doc/qt6/qtstatemachine/images/statemachine-button.png
/usr/share/doc/qt6/qtstatemachine/images/statemachine-customevents.png
/usr/share/doc/qt6/qtstatemachine/images/statemachine-customevents2.png
/usr/share/doc/qt6/qtstatemachine/images/statemachine-finished.png
/usr/share/doc/qt6/qtstatemachine/images/statemachine-nonparallel.png
/usr/share/doc/qt6/qtstatemachine/images/statemachine-parallel.png
/usr/share/doc/qt6/qtstatemachine/images/trafficlight-example.png
/usr/share/doc/qt6/qtstatemachine/images/trafficlight-example1.png
/usr/share/doc/qt6/qtstatemachine/images/trafficlight-example2.png
/usr/share/doc/qt6/qtstatemachine/qabstractstate-members.html
/usr/share/doc/qt6/qtstatemachine/qabstractstate.html
/usr/share/doc/qt6/qtstatemachine/qabstracttransition-members.html
/usr/share/doc/qt6/qtstatemachine/qabstracttransition.html
/usr/share/doc/qt6/qtstatemachine/qeventtransition-members.html
/usr/share/doc/qt6/qtstatemachine/qeventtransition.html
/usr/share/doc/qt6/qtstatemachine/qfinalstate-members.html
/usr/share/doc/qt6/qtstatemachine/qfinalstate.html
/usr/share/doc/qt6/qtstatemachine/qhistorystate-members.html
/usr/share/doc/qt6/qtstatemachine/qhistorystate.html
/usr/share/doc/qt6/qtstatemachine/qkeyeventtransition-members.html
/usr/share/doc/qt6/qtstatemachine/qkeyeventtransition.html
/usr/share/doc/qt6/qtstatemachine/qml-qtqml-statemachine-finalstate-members.html
/usr/share/doc/qt6/qtstatemachine/qml-qtqml-statemachine-finalstate.html
/usr/share/doc/qt6/qtstatemachine/qml-qtqml-statemachine-historystate-members.html
/usr/share/doc/qt6/qtstatemachine/qml-qtqml-statemachine-historystate.html
/usr/share/doc/qt6/qtstatemachine/qml-qtqml-statemachine-qabstractstate-members.html
/usr/share/doc/qt6/qtstatemachine/qml-qtqml-statemachine-qabstractstate.html
/usr/share/doc/qt6/qtstatemachine/qml-qtqml-statemachine-qabstracttransition-members.html
/usr/share/doc/qt6/qtstatemachine/qml-qtqml-statemachine-qabstracttransition.html
/usr/share/doc/qt6/qtstatemachine/qml-qtqml-statemachine-qsignaltransition-members.html
/usr/share/doc/qt6/qtstatemachine/qml-qtqml-statemachine-qsignaltransition.html
/usr/share/doc/qt6/qtstatemachine/qml-qtqml-statemachine-signaltransition-members.html
/usr/share/doc/qt6/qtstatemachine/qml-qtqml-statemachine-signaltransition.html
/usr/share/doc/qt6/qtstatemachine/qml-qtqml-statemachine-state-members.html
/usr/share/doc/qt6/qtstatemachine/qml-qtqml-statemachine-state.html
/usr/share/doc/qt6/qtstatemachine/qml-qtqml-statemachine-statemachine-members.html
/usr/share/doc/qt6/qtstatemachine/qml-qtqml-statemachine-statemachine.html
/usr/share/doc/qt6/qtstatemachine/qml-qtqml-statemachine-timeouttransition-members.html
/usr/share/doc/qt6/qtstatemachine/qml-qtqml-statemachine-timeouttransition.html
/usr/share/doc/qt6/qtstatemachine/qmlstatemachine-qml-guide.html
/usr/share/doc/qt6/qtstatemachine/qmouseeventtransition-members.html
/usr/share/doc/qt6/qtstatemachine/qmouseeventtransition.html
/usr/share/doc/qt6/qtstatemachine/qsignaltransition-members.html
/usr/share/doc/qt6/qtstatemachine/qsignaltransition.html
/usr/share/doc/qt6/qtstatemachine/qstate-members.html
/usr/share/doc/qt6/qtstatemachine/qstate.html
/usr/share/doc/qt6/qtstatemachine/qstatemachine-members.html
/usr/share/doc/qt6/qtstatemachine/qstatemachine-obsolete.html
/usr/share/doc/qt6/qtstatemachine/qstatemachine-signalevent-members.html
/usr/share/doc/qt6/qtstatemachine/qstatemachine-signalevent.html
/usr/share/doc/qt6/qtstatemachine/qstatemachine-wrappedevent-members.html
/usr/share/doc/qt6/qtstatemachine/qstatemachine-wrappedevent.html
/usr/share/doc/qt6/qtstatemachine/qstatemachine.html
/usr/share/doc/qt6/qtstatemachine/qtqml-statemachine-qmlmodule.html
/usr/share/doc/qt6/qtstatemachine/qtstatemachine-changes-qt6.html
/usr/share/doc/qt6/qtstatemachine/qtstatemachine-cpp-guide.html
/usr/share/doc/qt6/qtstatemachine/qtstatemachine-index.html
/usr/share/doc/qt6/qtstatemachine/qtstatemachine-module.html
/usr/share/doc/qt6/qtstatemachine/qtstatemachine-moveblocks-example.html
/usr/share/doc/qt6/qtstatemachine/qtstatemachine-overview.html
/usr/share/doc/qt6/qtstatemachine/qtstatemachine-pingpong-example.html
/usr/share/doc/qt6/qtstatemachine/qtstatemachine-rogue-example.html
/usr/share/doc/qt6/qtstatemachine/qtstatemachine-trafficlight-example.html
/usr/share/doc/qt6/qtstatemachine/qtstatemachine.index
/usr/share/doc/qt6/qtstatemachine/qtstatemachine.qhp
/usr/share/doc/qt6/qtstatemachine/qtstatemachine.qhp.sha1
/usr/share/doc/qt6/qtstatemachine/style
/usr/share/doc/qt6/qtstatemachine/style/offline-dark.css
/usr/share/doc/qt6/qtstatemachine/style/offline-simple.css
/usr/share/doc/qt6/qtstatemachine/style/offline.css
/usr/share/doc/qt6/qtsvg/images
/usr/share/doc/qt6/qtsvg/images/arrow_bc.png
/usr/share/doc/qt6/qtsvg/images/bgrContent.png
/usr/share/doc/qt6/qtsvg/images/btn_next.png
/usr/share/doc/qt6/qtsvg/images/btn_prev.png
/usr/share/doc/qt6/qtsvg/images/bullet_dn.png
/usr/share/doc/qt6/qtsvg/images/bullet_sq.png
/usr/share/doc/qt6/qtsvg/images/home.png
/usr/share/doc/qt6/qtsvg/images/ico_note.png
/usr/share/doc/qt6/qtsvg/images/ico_note_attention.png
/usr/share/doc/qt6/qtsvg/images/ico_out.png
/usr/share/doc/qt6/qtsvg/images/logo.png
/usr/share/doc/qt6/qtsvg/qgraphicssvgitem-members.html
/usr/share/doc/qt6/qtsvg/qgraphicssvgitem-obsolete.html
/usr/share/doc/qt6/qtsvg/qgraphicssvgitem.html
/usr/share/doc/qt6/qtsvg/qsvggenerator-members.html
/usr/share/doc/qt6/qtsvg/qsvggenerator.html
/usr/share/doc/qt6/qtsvg/qsvgrenderer-members.html
/usr/share/doc/qt6/qtsvg/qsvgrenderer.html
/usr/share/doc/qt6/qtsvg/qsvgwidget-members.html
/usr/share/doc/qt6/qtsvg/qsvgwidget.html
/usr/share/doc/qt6/qtsvg/qtsvg-attribution-xsvg.html
/usr/share/doc/qt6/qtsvg/qtsvg-changes-qt6.html
/usr/share/doc/qt6/qtsvg/qtsvg-index.html
/usr/share/doc/qt6/qtsvg/qtsvg-module.html
/usr/share/doc/qt6/qtsvg/qtsvg.index
/usr/share/doc/qt6/qtsvg/qtsvg.qhp
/usr/share/doc/qt6/qtsvg/qtsvg.qhp.sha1
/usr/share/doc/qt6/qtsvg/qtsvgwidgets-module.html
/usr/share/doc/qt6/qtsvg/style
/usr/share/doc/qt6/qtsvg/style/offline-dark.css
/usr/share/doc/qt6/qtsvg/style/offline-simple.css
/usr/share/doc/qt6/qtsvg/style/offline.css
/usr/share/doc/qt6/qtsvg/svgrendering.html
/usr/share/doc/qt6/qttestlib/images
/usr/share/doc/qt6/qttestlib/images/arrow_bc.png
/usr/share/doc/qt6/qttestlib/images/bgrContent.png
/usr/share/doc/qt6/qttestlib/images/btn_next.png
/usr/share/doc/qt6/qttestlib/images/btn_prev.png
/usr/share/doc/qt6/qttestlib/images/bullet_dn.png
/usr/share/doc/qt6/qttestlib/images/bullet_sq.png
/usr/share/doc/qt6/qttestlib/images/home.png
/usr/share/doc/qt6/qttestlib/images/ico_note.png
/usr/share/doc/qt6/qttestlib/images/ico_note_attention.png
/usr/share/doc/qt6/qttestlib/images/ico_out.png
/usr/share/doc/qt6/qttestlib/images/logo.png
/usr/share/doc/qt6/qttestlib/qabstractitemmodeltester-members.html
/usr/share/doc/qt6/qttestlib/qabstractitemmodeltester.html
/usr/share/doc/qt6/qttestlib/qsignalspy-members.html
/usr/share/doc/qt6/qttestlib/qsignalspy.html
/usr/share/doc/qt6/qttestlib/qtest-obsolete.html
/usr/share/doc/qt6/qttestlib/qtest-overview.html
/usr/share/doc/qt6/qttestlib/qtest-qtoucheventsequence-members.html
/usr/share/doc/qt6/qttestlib/qtest-qtoucheventsequence.html
/usr/share/doc/qt6/qttestlib/qtest-tutorial.html
/usr/share/doc/qt6/qttestlib/qtest.html
/usr/share/doc/qt6/qttestlib/qtesteventlist-members.html
/usr/share/doc/qt6/qttestlib/qtesteventlist.html
/usr/share/doc/qt6/qttestlib/qttest-best-practices-qdoc.html
/usr/share/doc/qt6/qttestlib/qttest-index.html
/usr/share/doc/qt6/qttestlib/qttest-module.html
/usr/share/doc/qt6/qttestlib/qttestlib-attribution-catch2.html
/usr/share/doc/qt6/qttestlib/qttestlib-attribution-cycle.html
/usr/share/doc/qt6/qttestlib/qttestlib-attribution-linuxperf.html
/usr/share/doc/qt6/qttestlib/qttestlib-attribution-valgrind.html
/usr/share/doc/qt6/qttestlib/qttestlib-tutorial1-example.html
/usr/share/doc/qt6/qttestlib/qttestlib-tutorial2-example.html
/usr/share/doc/qt6/qttestlib/qttestlib-tutorial3-example.html
/usr/share/doc/qt6/qttestlib/qttestlib-tutorial4-example.html
/usr/share/doc/qt6/qttestlib/qttestlib-tutorial5-example.html
/usr/share/doc/qt6/qttestlib/qttestlib-tutorial6.html
/usr/share/doc/qt6/qttestlib/qttestlib.index
/usr/share/doc/qt6/qttestlib/qttestlib.qhp
/usr/share/doc/qt6/qttestlib/qttestlib.qhp.sha1
/usr/share/doc/qt6/qttestlib/style
/usr/share/doc/qt6/qttestlib/style/offline-dark.css
/usr/share/doc/qt6/qttestlib/style/offline-simple.css
/usr/share/doc/qt6/qttestlib/style/offline.css
/usr/share/doc/qt6/qttestlib/testlib-changes-qt6.html
/usr/share/doc/qt6/qttexttospeech/examples-manifest.xml
/usr/share/doc/qt6/qttexttospeech/images
/usr/share/doc/qt6/qttexttospeech/images/arrow_bc.png
/usr/share/doc/qt6/qttexttospeech/images/bgrContent.png
/usr/share/doc/qt6/qttexttospeech/images/btn_next.png
/usr/share/doc/qt6/qttexttospeech/images/btn_prev.png
/usr/share/doc/qt6/qttexttospeech/images/bullet_dn.png
/usr/share/doc/qt6/qttexttospeech/images/bullet_sq.png
/usr/share/doc/qt6/qttexttospeech/images/hellospeak-example.png
/usr/share/doc/qt6/qttexttospeech/images/home.png
/usr/share/doc/qt6/qttexttospeech/images/ico_note.png
/usr/share/doc/qt6/qttexttospeech/images/ico_note_attention.png
/usr/share/doc/qt6/qttexttospeech/images/ico_out.png
/usr/share/doc/qt6/qttexttospeech/images/logo.png
/usr/share/doc/qt6/qttexttospeech/images/quickspeech-example.png
/usr/share/doc/qt6/qttexttospeech/images/status.gif
/usr/share/doc/qt6/qttexttospeech/qml-qttexttospeech-texttospeech-members.html
/usr/share/doc/qt6/qttexttospeech/qml-qttexttospeech-texttospeech.html
/usr/share/doc/qt6/qttexttospeech/qml-qttexttospeech-voice-members.html
/usr/share/doc/qt6/qttexttospeech/qml-qttexttospeech-voice.html
/usr/share/doc/qt6/qttexttospeech/qml-qttexttospeech-voiceselector-members.html
/usr/share/doc/qt6/qttexttospeech/qml-qttexttospeech-voiceselector.html
/usr/share/doc/qt6/qttexttospeech/qtexttospeech-members.html
/usr/share/doc/qt6/qttexttospeech/qtexttospeech.html
/usr/share/doc/qt6/qttexttospeech/qttexttospeech-changes-qt6.html
/usr/share/doc/qt6/qttexttospeech/qttexttospeech-engines.html
/usr/share/doc/qt6/qttexttospeech/qttexttospeech-examples.html
/usr/share/doc/qt6/qttexttospeech/qttexttospeech-hello-speak-example.html
/usr/share/doc/qt6/qttexttospeech/qttexttospeech-index.html
/usr/share/doc/qt6/qttexttospeech/qttexttospeech-module.html
/usr/share/doc/qt6/qttexttospeech/qttexttospeech-qmlmodule.html
/usr/share/doc/qt6/qttexttospeech/qttexttospeech-quickspeech-example.html
/usr/share/doc/qt6/qttexttospeech/qttexttospeech.index
/usr/share/doc/qt6/qttexttospeech/qttexttospeech.qhp
/usr/share/doc/qt6/qttexttospeech/qttexttospeech.qhp.sha1
/usr/share/doc/qt6/qttexttospeech/qvoice-members.html
/usr/share/doc/qt6/qttexttospeech/qvoice.html
/usr/share/doc/qt6/qttexttospeech/style
/usr/share/doc/qt6/qttexttospeech/style/offline-dark.css
/usr/share/doc/qt6/qttexttospeech/style/offline-simple.css
/usr/share/doc/qt6/qttexttospeech/style/offline.css
/usr/share/doc/qt6/qtuitools/examples-manifest.xml
/usr/share/doc/qt6/qtuitools/examples-qtuitools.html
/usr/share/doc/qt6/qtuitools/images
/usr/share/doc/qt6/qtuitools/images/arrow_bc.png
/usr/share/doc/qt6/qtuitools/images/bgrContent.png
/usr/share/doc/qt6/qtuitools/images/btn_next.png
/usr/share/doc/qt6/qtuitools/images/btn_prev.png
/usr/share/doc/qt6/qtuitools/images/bullet_dn.png
/usr/share/doc/qt6/qtuitools/images/bullet_sq.png
/usr/share/doc/qt6/qtuitools/images/home.png
/usr/share/doc/qt6/qtuitools/images/ico_note.png
/usr/share/doc/qt6/qtuitools/images/ico_note_attention.png
/usr/share/doc/qt6/qtuitools/images/ico_out.png
/usr/share/doc/qt6/qtuitools/images/logo.png
/usr/share/doc/qt6/qtuitools/images/textfinder-example-find.webp
/usr/share/doc/qt6/qtuitools/images/textfinder-example-find2.webp
/usr/share/doc/qt6/qtuitools/images/textfinder-example-userinterface.webp
/usr/share/doc/qt6/qtuitools/images/uitools-examples.png
/usr/share/doc/qt6/qtuitools/qtuitools-index.html
/usr/share/doc/qt6/qtuitools/qtuitools-module.html
/usr/share/doc/qt6/qtuitools/qtuitools-textfinder-example.html
/usr/share/doc/qt6/qtuitools/qtuitools.index
/usr/share/doc/qt6/qtuitools/qtuitools.qhp
/usr/share/doc/qt6/qtuitools/qtuitools.qhp.sha1
/usr/share/doc/qt6/qtuitools/quiloader-members.html
/usr/share/doc/qt6/qtuitools/quiloader.html
/usr/share/doc/qt6/qtuitools/style
/usr/share/doc/qt6/qtuitools/style/offline-dark.css
/usr/share/doc/qt6/qtuitools/style/offline-simple.css
/usr/share/doc/qt6/qtuitools/style/offline.css
/usr/share/doc/qt6/qtvirtualkeyboard/examples-manifest.xml
/usr/share/doc/qt6/qtvirtualkeyboard/handwriting.html
/usr/share/doc/qt6/qtvirtualkeyboard/images
/usr/share/doc/qt6/qtvirtualkeyboard/images/arrow_bc.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/basic-example.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/bgrContent.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/btn_next.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/btn_prev.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/bullet_dn.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/bullet_sq.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/gesture-double-left.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/gesture-double-up.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/gesture-single-down-left.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/gesture-single-left.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/gesture-single-right.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/gesture-single-up.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/handwriting-mode-icon.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/handwriting.gif
/usr/share/doc/qt6/qtvirtualkeyboard/images/home.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/ico_note.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/ico_note_attention.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/ico_out.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/language-icon.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/logo.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-ar_AR.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-bg_BG-latin.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-bg_BG.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-cs_CZ.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-da_DK.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-de_DE.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-el_GR-latin.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-el_GR.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-en_GB.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-en_US.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-es_ES.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-es_MX.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-et_EE.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-fa_FA.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-fi_FI.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-fr_CA.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-fr_FR.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-he_IL-latin.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-he_IL.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-hi_IN.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-hr_HR.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-hu_HU.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-id_ID.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-it_IT.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-ja_JP-full-width.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-ja_JP-hiragana.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-ja_JP-katakana.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-ja_JP-latin.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-ko_KR.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-ms_MY.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-nb_NO.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-nl_NL.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-pl_PL.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-pt_BR.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-pt_PT.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-ro_RO.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-ru_RU.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-sk_SK.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-sl_SI.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-sq_AL.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-sr_SP-latin.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-sr_SP.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-sv_SE.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-th_TH.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-tr_TR.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-uk_UA.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-vi_VN.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-zh_CN.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-zh_TW-cangjie.png
/usr/share/doc/qt6/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-zh_TW-zhuyin.png
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-backspacekey-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-backspacekey.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-basekey-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-basekey.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-changelanguagekey-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-changelanguagekey.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-enterkey-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-enterkey.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-fillerkey-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-fillerkey.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-flickkey-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-flickkey.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-handwritingmodekey-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-handwritingmodekey.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-hidekeyboardkey-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-hidekeyboardkey.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-inputmodekey-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-inputmodekey.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-key-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-key.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-keyboardcolumn-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-keyboardcolumn.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-keyboardlayout-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-keyboardlayout.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-keyboardlayoutloader-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-keyboardlayoutloader.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-keyboardrow-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-keyboardrow.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-modekey-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-modekey.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-numberkey-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-numberkey.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-shiftkey-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-shiftkey.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-spacekey-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-spacekey.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-symbolmodekey-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-symbolmodekey.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-traceinputarea-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-traceinputarea.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-traceinputkey-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-components-traceinputkey.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-enterkeyaction-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-enterkeyaction.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-handwritinginputpanel-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-handwritinginputpanel.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputcontext-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputcontext-obsolete.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputcontext.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputengine-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputengine.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputmethod-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputmethod.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputpanel-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputpanel.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-keyboardobserver-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-keyboardobserver.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-selectionlistmodel-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-selectionlistmodel.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-settings-virtualkeyboardsettings-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-settings-virtualkeyboardsettings.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-shifthandler-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-shifthandler.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-keyboardstyle-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-keyboardstyle.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-keyicon-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-keyicon.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-keypanel-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-keypanel.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-selectionlistitem-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-selectionlistitem.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-tracecanvas-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-tracecanvas.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-traceinputkeypanel-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-traceinputkeypanel.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-trace-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-trace.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-virtualkeyboard-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-virtualkeyboard.html
/usr/share/doc/qt6/qtvirtualkeyboard/qtquick-virtualkeyboard-components-qmlmodule.html
/usr/share/doc/qt6/qtvirtualkeyboard/qtquick-virtualkeyboard-for-advanced-use-cases.html
/usr/share/doc/qt6/qtvirtualkeyboard/qtquick-virtualkeyboard-for-application.html
/usr/share/doc/qt6/qtvirtualkeyboard/qtquick-virtualkeyboard-qmlmodule.html
/usr/share/doc/qt6/qtvirtualkeyboard/qtquick-virtualkeyboard-settings-qmlmodule.html
/usr/share/doc/qt6/qtvirtualkeyboard/qtquick-virtualkeyboard-styles-qmlmodule.html
/usr/share/doc/qt6/qtvirtualkeyboard/qtvirtualkeyboard-attribution-openwnn.html
/usr/share/doc/qt6/qtvirtualkeyboard/qtvirtualkeyboard-attribution-pinyin.html
/usr/share/doc/qt6/qtvirtualkeyboard/qtvirtualkeyboard-attribution-tcime.html
/usr/share/doc/qt6/qtvirtualkeyboard/qtvirtualkeyboard-basic-example.html
/usr/share/doc/qt6/qtvirtualkeyboard/qtvirtualkeyboard-build.html
/usr/share/doc/qt6/qtvirtualkeyboard/qtvirtualkeyboard-deployment-guide.html
/usr/share/doc/qt6/qtvirtualkeyboard/qtvirtualkeyboard-examples.html
/usr/share/doc/qt6/qtvirtualkeyboard/qtvirtualkeyboard-index.html
/usr/share/doc/qt6/qtvirtualkeyboard/qtvirtualkeyboard-layouts.html
/usr/share/doc/qt6/qtvirtualkeyboard/qtvirtualkeyboard-module.html
/usr/share/doc/qt6/qtvirtualkeyboard/qtvirtualkeyboard-overview.html
/usr/share/doc/qt6/qtvirtualkeyboard/qtvirtualkeyboard-qmltypes.html
/usr/share/doc/qt6/qtvirtualkeyboard/qtvirtualkeyboard-user-guide.html
/usr/share/doc/qt6/qtvirtualkeyboard/qtvirtualkeyboard.html
/usr/share/doc/qt6/qtvirtualkeyboard/qtvirtualkeyboard.index
/usr/share/doc/qt6/qtvirtualkeyboard/qtvirtualkeyboard.qhp
/usr/share/doc/qt6/qtvirtualkeyboard/qtvirtualkeyboard.qhp.sha1
/usr/share/doc/qt6/qtvirtualkeyboard/qvirtualkeyboardabstractinputmethod-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qvirtualkeyboardabstractinputmethod.html
/usr/share/doc/qt6/qtvirtualkeyboard/qvirtualkeyboarddictionary-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qvirtualkeyboarddictionary.html
/usr/share/doc/qt6/qtvirtualkeyboard/qvirtualkeyboarddictionarymanager-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qvirtualkeyboarddictionarymanager.html
/usr/share/doc/qt6/qtvirtualkeyboard/qvirtualkeyboardinputcontext-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qvirtualkeyboardinputcontext-obsolete.html
/usr/share/doc/qt6/qtvirtualkeyboard/qvirtualkeyboardinputcontext.html
/usr/share/doc/qt6/qtvirtualkeyboard/qvirtualkeyboardinputengine-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qvirtualkeyboardinputengine.html
/usr/share/doc/qt6/qtvirtualkeyboard/qvirtualkeyboardobserver-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qvirtualkeyboardobserver.html
/usr/share/doc/qt6/qtvirtualkeyboard/qvirtualkeyboardselectionlistmodel-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qvirtualkeyboardselectionlistmodel.html
/usr/share/doc/qt6/qtvirtualkeyboard/qvirtualkeyboardtrace-members.html
/usr/share/doc/qt6/qtvirtualkeyboard/qvirtualkeyboardtrace.html
/usr/share/doc/qt6/qtvirtualkeyboard/style
/usr/share/doc/qt6/qtvirtualkeyboard/style/offline-dark.css
/usr/share/doc/qt6/qtvirtualkeyboard/style/offline-simple.css
/usr/share/doc/qt6/qtvirtualkeyboard/style/offline.css
/usr/share/doc/qt6/qtvirtualkeyboard/xt9.html
/usr/share/doc/qt6/qtwaylandcompositor/examples-manifest.xml
/usr/share/doc/qt6/qtwaylandcompositor/images
/usr/share/doc/qt6/qtwaylandcompositor/images/arrow_bc.png
/usr/share/doc/qt6/qtwaylandcompositor/images/bgrContent.png
/usr/share/doc/qt6/qtwaylandcompositor/images/btn_next.png
/usr/share/doc/qt6/qtwaylandcompositor/images/btn_prev.png
/usr/share/doc/qt6/qtwaylandcompositor/images/bullet_dn.png
/usr/share/doc/qt6/qtwaylandcompositor/images/bullet_sq.png
/usr/share/doc/qt6/qtwaylandcompositor/images/custom-extension.png
/usr/share/doc/qt6/qtwaylandcompositor/images/custom-shell.jpg
/usr/share/doc/qt6/qtwaylandcompositor/images/home.png
/usr/share/doc/qt6/qtwaylandcompositor/images/ico_note.png
/usr/share/doc/qt6/qtwaylandcompositor/images/ico_note_attention.png
/usr/share/doc/qt6/qtwaylandcompositor/images/ico_out.png
/usr/share/doc/qt6/qtwaylandcompositor/images/ivi-compositor-1.png
/usr/share/doc/qt6/qtwaylandcompositor/images/ivi-compositor-2.png
/usr/share/doc/qt6/qtwaylandcompositor/images/ivi-compositor-3.png
/usr/share/doc/qt6/qtwaylandcompositor/images/logo.png
/usr/share/doc/qt6/qtwaylandcompositor/images/minimal-cpp.jpg
/usr/share/doc/qt6/qtwaylandcompositor/images/minimal-qml.png
/usr/share/doc/qt6/qtwaylandcompositor/images/multi-output.jpg
/usr/share/doc/qt6/qtwaylandcompositor/images/multi-screen.jpg
/usr/share/doc/qt6/qtwaylandcompositor/images/overview-compositor.jpg
/usr/share/doc/qt6/qtwaylandcompositor/images/qtshell.jpg
/usr/share/doc/qt6/qtwaylandcompositor/images/server-side-decoration.png
/usr/share/doc/qt6/qtwaylandcompositor/images/spanning-screens.jpg
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-idleinhibitmanagerv1-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-idleinhibitmanagerv1.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-iviapplication-iviapplication-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-iviapplication-iviapplication.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-iviapplication-ivisurface-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-iviapplication-ivisurface.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-presentationtime-presentationtime-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-presentationtime-presentationtime.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-qtshell-qtshell-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-qtshell-qtshell.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-qtshell-qtshellchrome-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-qtshell-qtshellchrome.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-qtshell-qtshellsurface-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-qtshell-qtshellsurface.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-qttextinputmethodmanager-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-qttextinputmethodmanager.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-shellsurface-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-shellsurface.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-shellsurfaceitem-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-shellsurfaceitem.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-textinputmanager-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-textinputmanager.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-waylandclient-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-waylandclient.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-waylandcompositor-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-waylandcompositor.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-waylandhardwarelayer-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-waylandhardwarelayer.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-waylandoutput-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-waylandoutput.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-waylandquickitem-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-waylandquickitem.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-waylandseat-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-waylandseat.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-waylandsurface-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-waylandsurface.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-waylandview-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-waylandview.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-wlshell-wlshell-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-wlshell-wlshell.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-wlshell-wlshellsurface-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-wlshell-wlshellsurface.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-xdgshell-xdgdecorationmanagerv1-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-xdgshell-xdgdecorationmanagerv1.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-xdgshell-xdgoutputmanagerv1-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-xdgshell-xdgoutputmanagerv1.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-xdgshell-xdgpopup-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-xdgshell-xdgpopup.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-xdgshell-xdgshell-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-xdgshell-xdgshell.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-xdgshell-xdgsurface-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-xdgshell-xdgsurface.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-xdgshell-xdgtoplevel-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qml-qtwayland-compositor-xdgshell-xdgtoplevel.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwayland-changes-qt6.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwayland-compositor-iviapplication-qmlmodule.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwayland-compositor-presentationtime-qmlmodule.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwayland-compositor-qmlmodule.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwayland-compositor-qtshell-qmlmodule.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwayland-compositor-wlshell-qmlmodule.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwayland-compositor-xdgshell-qmlmodule.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-attribution-fractional-scale-v1.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-attribution-presentation-time-xml.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-eglstream-controller.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-fullscreen-protocol.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-ivi-extension-protocol.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-linux-dmabuf-unstable-v1.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-pointer-gestures-protocol.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-primary-selection-protocol.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-protocol.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-scaler-protocol.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-tablet-protocol.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-text-input-unstable-v1.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-text-input-unstable-v2.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-text-input-unstable-v4-wip.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-viewporter-protocol.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-xdg-activation.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-xdg-decoration-protocol.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-xdg-output-protocol.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-xdg-shell-protocol.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-attribution-xdg-foreign-unstable-v2.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-custom-extension-example.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-custom-shell-example.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-examples.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-fancy-compositor-example.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-index.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-ivi-compositor-example.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-minimal-cpp-example.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-minimal-qml-example.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-module.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-multi-output-example.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-multi-screen-example.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-overview-compositor-example.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-qtshell-example.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-server-side-decoration-example.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-shellextensions.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor-spanning-screens-example.html
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor.index
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor.qhp
/usr/share/doc/qt6/qtwaylandcompositor/qtwaylandcompositor.qhp.sha1
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandbufferref-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandbufferref.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandclient-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandclient.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandcompositor-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandcompositor.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandcompositorextension-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandcompositorextension.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandcompositorextensiontemplate-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandcompositorextensiontemplate.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandidleinhibitmanagerv1-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandidleinhibitmanagerv1.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandiviapplication-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandiviapplication.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandivisurface-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandivisurface.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandkeyboard-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandkeyboard.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandobject-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandobject.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandoutput-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandoutput.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandoutputmode-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandoutputmode.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandpointer-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandpointer.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandpresentationtime-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandpresentationtime.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandqttextinputmethodmanager-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandqttextinputmethodmanager.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandquickextension.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandquickitem-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandquickitem.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandquickshellintegration-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandquickshellintegration.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandquickshellsurfaceitem-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandquickshellsurfaceitem.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandresource-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandresource.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandseat-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandseat.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandshellsurface-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandshellsurface.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandshellsurfacetemplate-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandshellsurfacetemplate.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandsurface-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandsurface.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandsurfacegrabber-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandsurfacegrabber.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandsurfacerole-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandsurfacerole.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandtextinputmanager-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandtextinputmanager.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandtouch-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandtouch.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandview-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandview.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandviewporter-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandviewporter.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandwlshell-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandwlshell.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandwlshellsurface-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandwlshellsurface.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandxdgdecorationmanagerv1-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandxdgdecorationmanagerv1.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandxdgoutputmanagerv1-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandxdgoutputmanagerv1.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandxdgpopup-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandxdgpopup.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandxdgshell-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandxdgshell.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandxdgsurface-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandxdgsurface.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandxdgtoplevel-members.html
/usr/share/doc/qt6/qtwaylandcompositor/qwaylandxdgtoplevel.html
/usr/share/doc/qt6/qtwaylandcompositor/style
/usr/share/doc/qt6/qtwaylandcompositor/style/offline-dark.css
/usr/share/doc/qt6/qtwaylandcompositor/style/offline-simple.css
/usr/share/doc/qt6/qtwaylandcompositor/style/offline.css
/usr/share/doc/qt6/qtwebchannel/examples-manifest.xml
/usr/share/doc/qt6/qtwebchannel/images
/usr/share/doc/qt6/qtwebchannel/images/arrow_bc.png
/usr/share/doc/qt6/qtwebchannel/images/bgrContent.png
/usr/share/doc/qt6/qtwebchannel/images/btn_next.png
/usr/share/doc/qt6/qtwebchannel/images/btn_prev.png
/usr/share/doc/qt6/qtwebchannel/images/bullet_dn.png
/usr/share/doc/qt6/qtwebchannel/images/bullet_sq.png
/usr/share/doc/qt6/qtwebchannel/images/chatclient-html.png
/usr/share/doc/qt6/qtwebchannel/images/chatclient-qml.png
/usr/share/doc/qt6/qtwebchannel/images/chatserver-cpp.png
/usr/share/doc/qt6/qtwebchannel/images/home.png
/usr/share/doc/qt6/qtwebchannel/images/ico_note.png
/usr/share/doc/qt6/qtwebchannel/images/ico_note_attention.png
/usr/share/doc/qt6/qtwebchannel/images/ico_out.png
/usr/share/doc/qt6/qtwebchannel/images/logo.png
/usr/share/doc/qt6/qtwebchannel/images/standalone-screenshot.png
/usr/share/doc/qt6/qtwebchannel/qml-qtwebchannel-webchannel-members.html
/usr/share/doc/qt6/qtwebchannel/qml-qtwebchannel-webchannel.html
/usr/share/doc/qt6/qtwebchannel/qtwebchannel-changes-qt6.html
/usr/share/doc/qt6/qtwebchannel/qtwebchannel-chatclient-html-example.html
/usr/share/doc/qt6/qtwebchannel/qtwebchannel-chatclient-qml-example.html
/usr/share/doc/qt6/qtwebchannel/qtwebchannel-chatserver-cpp-example.html
/usr/share/doc/qt6/qtwebchannel/qtwebchannel-examples.html
/usr/share/doc/qt6/qtwebchannel/qtwebchannel-index.html
/usr/share/doc/qt6/qtwebchannel/qtwebchannel-javascript.html
/usr/share/doc/qt6/qtwebchannel/qtwebchannel-module.html
/usr/share/doc/qt6/qtwebchannel/qtwebchannel-qmlmodule.html
/usr/share/doc/qt6/qtwebchannel/qtwebchannel-standalone-example.html
/usr/share/doc/qt6/qtwebchannel/qtwebchannel.index
/usr/share/doc/qt6/qtwebchannel/qtwebchannel.qhp
/usr/share/doc/qt6/qtwebchannel/qtwebchannel.qhp.sha1
/usr/share/doc/qt6/qtwebchannel/qwebchannel-members.html
/usr/share/doc/qt6/qtwebchannel/qwebchannel.html
/usr/share/doc/qt6/qtwebchannel/qwebchannelabstracttransport-members.html
/usr/share/doc/qt6/qtwebchannel/qwebchannelabstracttransport.html
/usr/share/doc/qt6/qtwebchannel/style
/usr/share/doc/qt6/qtwebchannel/style/offline-dark.css
/usr/share/doc/qt6/qtwebchannel/style/offline-simple.css
/usr/share/doc/qt6/qtwebchannel/style/offline.css
/usr/share/doc/qt6/qtwebengine/examples-manifest.xml
/usr/share/doc/qt6/qtwebengine/images
/usr/share/doc/qt6/qtwebengine/images/arrow_bc.png
/usr/share/doc/qt6/qtwebengine/images/bgrContent.png
/usr/share/doc/qt6/qtwebengine/images/btn_next.png
/usr/share/doc/qt6/qtwebengine/images/btn_prev.png
/usr/share/doc/qt6/qtwebengine/images/bullet_dn.png
/usr/share/doc/qt6/qtwebengine/images/bullet_sq.png
/usr/share/doc/qt6/qtwebengine/images/contentmanipulation-example.png
/usr/share/doc/qt6/qtwebengine/images/cookiebrowser.png
/usr/share/doc/qt6/qtwebengine/images/granted.png
/usr/share/doc/qt6/qtwebengine/images/home.png
/usr/share/doc/qt6/qtwebengine/images/html2pdf-example.png
/usr/share/doc/qt6/qtwebengine/images/ico_note.png
/usr/share/doc/qt6/qtwebengine/images/ico_note_attention.png
/usr/share/doc/qt6/qtwebengine/images/ico_out.png
/usr/share/doc/qt6/qtwebengine/images/lifecycle-automatic.png
/usr/share/doc/qt6/qtwebengine/images/lifecycle-manual.png
/usr/share/doc/qt6/qtwebengine/images/lifecycle.png
/usr/share/doc/qt6/qtwebengine/images/logo.png
/usr/share/doc/qt6/qtwebengine/images/maps-example.png
/usr/share/doc/qt6/qtwebengine/images/notification.png
/usr/share/doc/qt6/qtwebengine/images/notifications-example.png
/usr/share/doc/qt6/qtwebengine/images/permissions.png
/usr/share/doc/qt6/qtwebengine/images/printme-example.png
/usr/share/doc/qt6/qtwebengine/images/push-notifications.png
/usr/share/doc/qt6/qtwebengine/images/qtwebengine-architecture.png
/usr/share/doc/qt6/qtwebengine/images/qtwebengine-model.png
/usr/share/doc/qt6/qtwebengine/images/qtwebenginewidgets-model.png
/usr/share/doc/qt6/qtwebengine/images/quicknanobrowser-demo.jpg
/usr/share/doc/qt6/qtwebengine/images/recipebrowser.webp
/usr/share/doc/qt6/qtwebengine/images/selection.png
/usr/share/doc/qt6/qtwebengine/images/simplebrowser-model.png
/usr/share/doc/qt6/qtwebengine/images/simplebrowser.png
/usr/share/doc/qt6/qtwebengine/images/spellchecker-example.png
/usr/share/doc/qt6/qtwebengine/images/videoplayer-example.png
/usr/share/doc/qt6/qtwebengine/images/website.png
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-authenticationdialogrequest-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-authenticationdialogrequest.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-colordialogrequest-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-colordialogrequest.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-contextmenurequest-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-contextmenurequest.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-filedialogrequest-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-filedialogrequest.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-findtextresult-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-findtextresult.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-fullscreenrequest-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-fullscreenrequest.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-javascriptdialogrequest-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-javascriptdialogrequest.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-quotarequest-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-quotarequest.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-registerprotocolhandlerrequest-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-registerprotocolhandlerrequest.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-tooltiprequest-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-tooltiprequest.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-touchselectionmenurequest-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-touchselectionmenurequest.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webengine-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webengine.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webengineaction-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webengineaction.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webenginecertificateerror-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webenginecertificateerror.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webengineclientcertificateoption-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webengineclientcertificateoption.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webengineclientcertificateselection-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webengineclientcertificateselection.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webenginedownloadrequest-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webenginedownloadrequest.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webenginehistory-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webenginehistory.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webenginehistorymodel-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webenginehistorymodel.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webengineloadinginfo-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webengineloadinginfo.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webenginenavigationrequest-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webenginenavigationrequest.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webenginenewwindowrequest-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webenginenewwindowrequest.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webenginenotification-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webenginenotification.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webengineprofile-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webengineprofile.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webenginescript-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webenginescript.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webenginescriptcollection-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webenginescriptcollection.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webenginesettings-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webenginesettings.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webengineview-members.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webengineview-obsolete.html
/usr/share/doc/qt6/qtwebengine/qml-qtwebengine-webengineview.html
/usr/share/doc/qt6/qtwebengine/qquickwebengineprofile-members.html
/usr/share/doc/qt6/qtwebengine/qquickwebengineprofile.html
/usr/share/doc/qt6/qtwebengine/qt-add-webengine-dictionary.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-abseil.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-alliance-for-open-media-video-codec.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-almost-native-graphics-layer-engine.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-android-explicit-synchronization.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-axe-core-accessibility-audit.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-boringssl.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-brotli.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-chromium-global.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-codemirror-6.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-compact-encoding-detection.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-compact-language-detector-v3.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-cpuinfo.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-crashpad.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-crc32c.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-dav1d-is-an-av1-decoder.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-dawn.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-devtools-frontend.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-dynamic-annotations.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-emoji-segmenter.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-expat-xml-parser.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-ffmpeg.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-fiat-crypto-synthesizing-correct-by-construction-code-for-cryptographic-primitives.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-flac.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-flatbuffers.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-fontconfig.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-google-double-conversion.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-google-glog-x27-s-symbolization-library.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-harfbuzz-ng.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-headers-for-the-windows-10-webauthn-api-webauthn-dll.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-highway-c-library-for-simd.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-hunspell.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-iccjpeg.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-icu.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-inspector-protocol.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-ipcz.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-jsoncpp.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-libavif-library-for-encoding-and-decoding-avif-files.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-libevent.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-libgav1.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-libpng.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-libsrtp.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-libvpx.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-libxml.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-libxslt.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-libyuv.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-lighthouse.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-material-color-utilities.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-mesa-headers.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-modp-base64-decoder.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-one-euro-filter.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-opus.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-ots-opentype-sanitizer.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-pdfium.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-perfetto.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-pffft-a-pretty-fast-fft.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-protocol-buffers.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-re2-an-efficient-principled-regular-expression-library.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-recurrent-neural-network-for-audio-noise-reduction.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-snappy-a-fast-compressor-decompressor.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-sqlite.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-the-chromium-project.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-the-incremental-distributed-point-functions-library.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-v8-fork-of-fdlibm.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-volk-meta-loader-for-vulkan-api.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-vulkan-deps.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-vulkanmemoryallocator.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-webkit.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-webm-container-parser-and-writer.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-webp-image-encoder-decoder.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-webrtc.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-woff2.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-wuffs-wrangling-untrusted-file-formats-safely.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-xdg-mime.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-xdg-user-dirs.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-3rdparty-zlib.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-attribution-cookiebrowser-tango.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-attribution-quicknanobrowser-tango.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-attribution-recipebrowser-markdowncss.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-attribution-recipebrowser-marked.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-attribution-simplebrowser-tango.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-changes-qt6.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-debugging.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-deploying.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-features.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-index.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-licensing.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-modules.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-overview.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-platform-notes.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-qmlmodule.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-webenginequick-lifecycle-example.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-webenginequick-quicknanobrowser-example.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-webenginewidgets-clientcertificate-example.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-webenginewidgets-contentmanipulation-example.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-webenginewidgets-cookiebrowser-example.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-webenginewidgets-html2pdf-example.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-webenginewidgets-maps-example.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-webenginewidgets-notifications-example.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-webenginewidgets-printme-example.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-webenginewidgets-push-notifications-example.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-webenginewidgets-recipebrowser-example.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-webenginewidgets-simplebrowser-example.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-webenginewidgets-spellchecker-example.html
/usr/share/doc/qt6/qtwebengine/qtwebengine-webenginewidgets-videoplayer-example.html
/usr/share/doc/qt6/qtwebengine/qtwebengine.index
/usr/share/doc/qt6/qtwebengine/qtwebengine.qhp
/usr/share/doc/qt6/qtwebengine/qtwebengine.qhp.sha1
/usr/share/doc/qt6/qtwebengine/qtwebenginecore-index.html
/usr/share/doc/qt6/qtwebengine/qtwebenginecore-module.html
/usr/share/doc/qt6/qtwebengine/qtwebenginecoreglobal-h.html
/usr/share/doc/qt6/qtwebengine/qtwebenginequick-module.html
/usr/share/doc/qt6/qtwebengine/qtwebenginequick.html
/usr/share/doc/qt6/qtwebengine/qtwebenginewidgets-index.html
/usr/share/doc/qt6/qtwebengine/qtwebenginewidgets-module.html
/usr/share/doc/qt6/qtwebengine/qtwebenginewidgets-qtwebkitportingguide.html
/usr/share/doc/qt6/qtwebengine/qwebenginecertificateerror-members.html
/usr/share/doc/qt6/qtwebengine/qwebenginecertificateerror.html
/usr/share/doc/qt6/qtwebengine/qwebengineclientcertificateselection-members.html
/usr/share/doc/qt6/qtwebengine/qwebengineclientcertificateselection.html
/usr/share/doc/qt6/qtwebengine/qwebengineclientcertificatestore-members.html
/usr/share/doc/qt6/qtwebengine/qwebengineclientcertificatestore.html
/usr/share/doc/qt6/qtwebengine/qwebenginecontextmenurequest-members.html
/usr/share/doc/qt6/qtwebengine/qwebenginecontextmenurequest.html
/usr/share/doc/qt6/qtwebengine/qwebenginecookiestore-filterrequest-members.html
/usr/share/doc/qt6/qtwebengine/qwebenginecookiestore-filterrequest.html
/usr/share/doc/qt6/qtwebengine/qwebenginecookiestore-members.html
/usr/share/doc/qt6/qtwebengine/qwebenginecookiestore.html
/usr/share/doc/qt6/qtwebengine/qwebenginedownloadrequest-members.html
/usr/share/doc/qt6/qtwebengine/qwebenginedownloadrequest.html
/usr/share/doc/qt6/qtwebengine/qwebenginefilesystemaccessrequest-members.html
/usr/share/doc/qt6/qtwebengine/qwebenginefilesystemaccessrequest.html
/usr/share/doc/qt6/qtwebengine/qwebenginefindtextresult-members.html
/usr/share/doc/qt6/qtwebengine/qwebenginefindtextresult.html
/usr/share/doc/qt6/qtwebengine/qwebenginefullscreenrequest-members.html
/usr/share/doc/qt6/qtwebengine/qwebenginefullscreenrequest.html
/usr/share/doc/qt6/qtwebengine/qwebengineglobalsettings-dnsmode-members.html
/usr/share/doc/qt6/qtwebengine/qwebengineglobalsettings-dnsmode.html
/usr/share/doc/qt6/qtwebengine/qwebengineglobalsettings.html
/usr/share/doc/qt6/qtwebengine/qwebenginehistory-members.html
/usr/share/doc/qt6/qtwebengine/qwebenginehistory.html
/usr/share/doc/qt6/qtwebengine/qwebenginehistoryitem-members.html
/usr/share/doc/qt6/qtwebengine/qwebenginehistoryitem.html
/usr/share/doc/qt6/qtwebengine/qwebenginehistorymodel-members.html
/usr/share/doc/qt6/qtwebengine/qwebenginehistorymodel.html
/usr/share/doc/qt6/qtwebengine/qwebenginehttprequest-members.html
/usr/share/doc/qt6/qtwebengine/qwebenginehttprequest.html
/usr/share/doc/qt6/qtwebengine/qwebengineloadinginfo-members.html
/usr/share/doc/qt6/qtwebengine/qwebengineloadinginfo.html
/usr/share/doc/qt6/qtwebengine/qwebenginenavigationrequest-members.html
/usr/share/doc/qt6/qtwebengine/qwebenginenavigationrequest.html
/usr/share/doc/qt6/qtwebengine/qwebenginenewwindowrequest-members.html
/usr/share/doc/qt6/qtwebengine/qwebenginenewwindowrequest.html
/usr/share/doc/qt6/qtwebengine/qwebenginenotification-members.html
/usr/share/doc/qt6/qtwebengine/qwebenginenotification.html
/usr/share/doc/qt6/qtwebengine/qwebenginepage-members.html
/usr/share/doc/qt6/qtwebengine/qwebenginepage-obsolete.html
/usr/share/doc/qt6/qtwebengine/qwebenginepage.html
/usr/share/doc/qt6/qtwebengine/qwebengineprofile-members.html
/usr/share/doc/qt6/qtwebengine/qwebengineprofile.html
/usr/share/doc/qt6/qtwebengine/qwebenginequotarequest-members.html
/usr/share/doc/qt6/qtwebengine/qwebenginequotarequest.html
/usr/share/doc/qt6/qtwebengine/qwebengineregisterprotocolhandlerrequest-members.html
/usr/share/doc/qt6/qtwebengine/qwebengineregisterprotocolhandlerrequest.html
/usr/share/doc/qt6/qtwebengine/qwebenginescript-members.html
/usr/share/doc/qt6/qtwebengine/qwebenginescript.html
/usr/share/doc/qt6/qtwebengine/qwebenginescriptcollection-members.html
/usr/share/doc/qt6/qtwebengine/qwebenginescriptcollection.html
/usr/share/doc/qt6/qtwebengine/qwebenginesettings-members.html
/usr/share/doc/qt6/qtwebengine/qwebenginesettings.html
/usr/share/doc/qt6/qtwebengine/qwebengineurlrequestinfo-members.html
/usr/share/doc/qt6/qtwebengine/qwebengineurlrequestinfo.html
/usr/share/doc/qt6/qtwebengine/qwebengineurlrequestinterceptor-members.html
/usr/share/doc/qt6/qtwebengine/qwebengineurlrequestinterceptor.html
/usr/share/doc/qt6/qtwebengine/qwebengineurlrequestjob-members.html
/usr/share/doc/qt6/qtwebengine/qwebengineurlrequestjob.html
/usr/share/doc/qt6/qtwebengine/qwebengineurlscheme-members.html
/usr/share/doc/qt6/qtwebengine/qwebengineurlscheme.html
/usr/share/doc/qt6/qtwebengine/qwebengineurlschemehandler-members.html
/usr/share/doc/qt6/qtwebengine/qwebengineurlschemehandler.html
/usr/share/doc/qt6/qtwebengine/qwebengineview-members.html
/usr/share/doc/qt6/qtwebengine/qwebengineview.html
/usr/share/doc/qt6/qtwebengine/style
/usr/share/doc/qt6/qtwebengine/style/offline-dark.css
/usr/share/doc/qt6/qtwebengine/style/offline-simple.css
/usr/share/doc/qt6/qtwebengine/style/offline.css
/usr/share/doc/qt6/qtwebengine/webengine-examples.html
/usr/share/doc/qt6/qtwebengine/webengine-widgetexamples.html
/usr/share/doc/qt6/qtwebsockets/echoclient.html
/usr/share/doc/qt6/qtwebsockets/echoserver.html
/usr/share/doc/qt6/qtwebsockets/examples-manifest.xml
/usr/share/doc/qt6/qtwebsockets/images
/usr/share/doc/qt6/qtwebsockets/images/arrow_bc.png
/usr/share/doc/qt6/qtwebsockets/images/bgrContent.png
/usr/share/doc/qt6/qtwebsockets/images/btn_next.png
/usr/share/doc/qt6/qtwebsockets/images/btn_prev.png
/usr/share/doc/qt6/qtwebsockets/images/bullet_dn.png
/usr/share/doc/qt6/qtwebsockets/images/bullet_sq.png
/usr/share/doc/qt6/qtwebsockets/images/echoclient-console-example.webp
/usr/share/doc/qt6/qtwebsockets/images/echoclient-html-example.png
/usr/share/doc/qt6/qtwebsockets/images/home.png
/usr/share/doc/qt6/qtwebsockets/images/ico_note.png
/usr/share/doc/qt6/qtwebsockets/images/ico_note_attention.png
/usr/share/doc/qt6/qtwebsockets/images/ico_out.png
/usr/share/doc/qt6/qtwebsockets/images/logo.png
/usr/share/doc/qt6/qtwebsockets/images/qmlwebsocketclient-example.webp
/usr/share/doc/qt6/qtwebsockets/images/qmlwebsocketserver-example.webp
/usr/share/doc/qt6/qtwebsockets/images/simplechat-html-example.webp
/usr/share/doc/qt6/qtwebsockets/images/sslechoclient-html-example.webp
/usr/share/doc/qt6/qtwebsockets/images/websockets-pictorial-representation.jpg
/usr/share/doc/qt6/qtwebsockets/qmaskgenerator-members.html
/usr/share/doc/qt6/qtwebsockets/qmaskgenerator.html
/usr/share/doc/qt6/qtwebsockets/qml-qtwebsockets-websocket-members.html
/usr/share/doc/qt6/qtwebsockets/qml-qtwebsockets-websocket.html
/usr/share/doc/qt6/qtwebsockets/qml-qtwebsockets-websocketserver-members.html
/usr/share/doc/qt6/qtwebsockets/qml-qtwebsockets-websocketserver.html
/usr/share/doc/qt6/qtwebsockets/qtwebsockets-changes-qt6.html
/usr/share/doc/qt6/qtwebsockets/qtwebsockets-echoclient-example.html
/usr/share/doc/qt6/qtwebsockets/qtwebsockets-echoserver-example.html
/usr/share/doc/qt6/qtwebsockets/qtwebsockets-examples.html
/usr/share/doc/qt6/qtwebsockets/qtwebsockets-index.html
/usr/share/doc/qt6/qtwebsockets/qtwebsockets-module.html
/usr/share/doc/qt6/qtwebsockets/qtwebsockets-qmlmodule.html
/usr/share/doc/qt6/qtwebsockets/qtwebsockets-qmlwebsocketclient-example.html
/usr/share/doc/qt6/qtwebsockets/qtwebsockets-qmlwebsocketserver-example.html
/usr/share/doc/qt6/qtwebsockets/qtwebsockets-simplechat-example.html
/usr/share/doc/qt6/qtwebsockets/qtwebsockets-sslechoclient-example.html
/usr/share/doc/qt6/qtwebsockets/qtwebsockets-sslechoserver-example.html
/usr/share/doc/qt6/qtwebsockets/qtwebsockets-testing.html
/usr/share/doc/qt6/qtwebsockets/qtwebsockets.index
/usr/share/doc/qt6/qtwebsockets/qtwebsockets.qhp
/usr/share/doc/qt6/qtwebsockets/qtwebsockets.qhp.sha1
/usr/share/doc/qt6/qtwebsockets/qwebsocket-members.html
/usr/share/doc/qt6/qtwebsockets/qwebsocket-obsolete.html
/usr/share/doc/qt6/qtwebsockets/qwebsocket.html
/usr/share/doc/qt6/qtwebsockets/qwebsocketcorsauthenticator-members.html
/usr/share/doc/qt6/qtwebsockets/qwebsocketcorsauthenticator.html
/usr/share/doc/qt6/qtwebsockets/qwebsockethandshakeoptions-members.html
/usr/share/doc/qt6/qtwebsockets/qwebsockethandshakeoptions.html
/usr/share/doc/qt6/qtwebsockets/qwebsocketprotocol.html
/usr/share/doc/qt6/qtwebsockets/qwebsocketserver-members.html
/usr/share/doc/qt6/qtwebsockets/qwebsocketserver-obsolete.html
/usr/share/doc/qt6/qtwebsockets/qwebsocketserver.html
/usr/share/doc/qt6/qtwebsockets/style
/usr/share/doc/qt6/qtwebsockets/style/offline-dark.css
/usr/share/doc/qt6/qtwebsockets/style/offline-simple.css
/usr/share/doc/qt6/qtwebsockets/style/offline.css
/usr/share/doc/qt6/qtwebsockets/websockets-overview.html
/usr/share/doc/qt6/qtwebview/examples-manifest.xml
/usr/share/doc/qt6/qtwebview/images
/usr/share/doc/qt6/qtwebview/images/arrow_bc.png
/usr/share/doc/qt6/qtwebview/images/bgrContent.png
/usr/share/doc/qt6/qtwebview/images/btn_next.png
/usr/share/doc/qt6/qtwebview/images/btn_prev.png
/usr/share/doc/qt6/qtwebview/images/bullet_dn.png
/usr/share/doc/qt6/qtwebview/images/bullet_sq.png
/usr/share/doc/qt6/qtwebview/images/home.png
/usr/share/doc/qt6/qtwebview/images/ico_note.png
/usr/share/doc/qt6/qtwebview/images/ico_note_attention.png
/usr/share/doc/qt6/qtwebview/images/ico_out.png
/usr/share/doc/qt6/qtwebview/images/logo.png
/usr/share/doc/qt6/qtwebview/images/webview-example.jpg
/usr/share/doc/qt6/qtwebview/qml-qtwebview-webview-members.html
/usr/share/doc/qt6/qtwebview/qml-qtwebview-webview.html
/usr/share/doc/qt6/qtwebview/qml-qtwebview-webviewloadrequest-members.html
/usr/share/doc/qt6/qtwebview/qml-qtwebview-webviewloadrequest.html
/usr/share/doc/qt6/qtwebview/qml-qtwebview-webviewsettings-members.html
/usr/share/doc/qt6/qtwebview/qml-qtwebview-webviewsettings.html
/usr/share/doc/qt6/qtwebview/qtwebview-changes-qt6.html
/usr/share/doc/qt6/qtwebview/qtwebview-examples.html
/usr/share/doc/qt6/qtwebview/qtwebview-index.html
/usr/share/doc/qt6/qtwebview/qtwebview-minibrowser-example.html
/usr/share/doc/qt6/qtwebview/qtwebview-module.html
/usr/share/doc/qt6/qtwebview/qtwebview-qmlmodule.html
/usr/share/doc/qt6/qtwebview/qtwebview.html
/usr/share/doc/qt6/qtwebview/qtwebview.index
/usr/share/doc/qt6/qtwebview/qtwebview.qhp
/usr/share/doc/qt6/qtwebview/qtwebview.qhp.sha1
/usr/share/doc/qt6/qtwebview/style
/usr/share/doc/qt6/qtwebview/style/offline-dark.css
/usr/share/doc/qt6/qtwebview/style/offline-simple.css
/usr/share/doc/qt6/qtwebview/style/offline.css
/usr/share/doc/qt6/qtwidgets/application-windows.html
/usr/share/doc/qt6/qtwidgets/dialogs.html
/usr/share/doc/qt6/qtwidgets/examples-desktop.html
/usr/share/doc/qt6/qtwidgets/examples-dialogs.html
/usr/share/doc/qt6/qtwidgets/examples-graphicsview.html
/usr/share/doc/qt6/qtwidgets/examples-itemviews.html
/usr/share/doc/qt6/qtwidgets/examples-mainwindow.html
/usr/share/doc/qt6/qtwidgets/examples-manifest.xml
/usr/share/doc/qt6/qtwidgets/examples-painting.html
/usr/share/doc/qt6/qtwidgets/examples-richtext.html
/usr/share/doc/qt6/qtwidgets/examples-widgets.html
/usr/share/doc/qt6/qtwidgets/focus.html
/usr/share/doc/qt6/qtwidgets/gallery.html
/usr/share/doc/qt6/qtwidgets/gestures-overview.html
/usr/share/doc/qt6/qtwidgets/graphicsview.html
/usr/share/doc/qt6/qtwidgets/images
/usr/share/doc/qt6/qtwidgets/images/addressbook-adddialog.png
/usr/share/doc/qt6/qtwidgets/images/addressbook-classes.png
/usr/share/doc/qt6/qtwidgets/images/addressbook-editdialog.png
/usr/share/doc/qt6/qtwidgets/images/addressbook-example.png
/usr/share/doc/qt6/qtwidgets/images/addressbook-filemenu.png
/usr/share/doc/qt6/qtwidgets/images/addressbook-newaddresstab.png
/usr/share/doc/qt6/qtwidgets/images/addressbook-signals.png
/usr/share/doc/qt6/qtwidgets/images/addressbook-toolsmenu.png
/usr/share/doc/qt6/qtwidgets/images/affine-demo.png
/usr/share/doc/qt6/qtwidgets/images/analogclock-example.png
/usr/share/doc/qt6/qtwidgets/images/analogclock-viewport.png
/usr/share/doc/qt6/qtwidgets/images/arrow_bc.png
/usr/share/doc/qt6/qtwidgets/images/assistant-toolbar.png
/usr/share/doc/qt6/qtwidgets/images/basicdrawing-example.png
/usr/share/doc/qt6/qtwidgets/images/basicgraphicslayouts-example.png
/usr/share/doc/qt6/qtwidgets/images/basiclayouts-example.png
/usr/share/doc/qt6/qtwidgets/images/basicsortfiltermodel-example.png
/usr/share/doc/qt6/qtwidgets/images/bgrContent.png
/usr/share/doc/qt6/qtwidgets/images/blurpickereffect-example.png
/usr/share/doc/qt6/qtwidgets/images/branchindicatorimage.png
/usr/share/doc/qt6/qtwidgets/images/btn_next.png
/usr/share/doc/qt6/qtwidgets/images/btn_prev.png
/usr/share/doc/qt6/qtwidgets/images/bullet_dn.png
/usr/share/doc/qt6/qtwidgets/images/bullet_sq.png
/usr/share/doc/qt6/qtwidgets/images/button.png
/usr/share/doc/qt6/qtwidgets/images/buttonbox-gnomelayout-horizontal.png
/usr/share/doc/qt6/qtwidgets/images/buttonbox-gnomelayout-vertical.png
/usr/share/doc/qt6/qtwidgets/images/buttonbox-kdelayout-horizontal.png
/usr/share/doc/qt6/qtwidgets/images/buttonbox-kdelayout-vertical.png
/usr/share/doc/qt6/qtwidgets/images/buttonbox-mac-modeless-horizontal.png
/usr/share/doc/qt6/qtwidgets/images/buttonbox-mac-modeless-vertical.png
/usr/share/doc/qt6/qtwidgets/images/buttonbox-maclayout-horizontal.png
/usr/share/doc/qt6/qtwidgets/images/buttonbox-maclayout-vertical.png
/usr/share/doc/qt6/qtwidgets/images/buttonbox-winlayout-horizontal.png
/usr/share/doc/qt6/qtwidgets/images/buttonbox-winlayout-vertical.png
/usr/share/doc/qt6/qtwidgets/images/calculator-example.png
/usr/share/doc/qt6/qtwidgets/images/calculator-ugly.png
/usr/share/doc/qt6/qtwidgets/images/calendarwidgetexample.png
/usr/share/doc/qt6/qtwidgets/images/checkbox.png
/usr/share/doc/qt6/qtwidgets/images/checkboxes-exclusive.png
/usr/share/doc/qt6/qtwidgets/images/checkboxes-non-exclusive.png
/usr/share/doc/qt6/qtwidgets/images/checkboxexample.png
/usr/share/doc/qt6/qtwidgets/images/chip-demo.png
/usr/share/doc/qt6/qtwidgets/images/clock.png
/usr/share/doc/qt6/qtwidgets/images/collapsed_combobox.png
/usr/share/doc/qt6/qtwidgets/images/collidingmice-example.png
/usr/share/doc/qt6/qtwidgets/images/coloreditorfactoryimage.png
/usr/share/doc/qt6/qtwidgets/images/columnview.png
/usr/share/doc/qt6/qtwidgets/images/combobox.png
/usr/share/doc/qt6/qtwidgets/images/comboboximage.png
/usr/share/doc/qt6/qtwidgets/images/combowidgetmapper-example.png
/usr/share/doc/qt6/qtwidgets/images/completer-example-country.png
/usr/share/doc/qt6/qtwidgets/images/completer-example-word.png
/usr/share/doc/qt6/qtwidgets/images/completer-example.png
/usr/share/doc/qt6/qtwidgets/images/composition-demo.png
/usr/share/doc/qt6/qtwidgets/images/conceptualpushbuttontree.png
/usr/share/doc/qt6/qtwidgets/images/customcompleter-example.png
/usr/share/doc/qt6/qtwidgets/images/customcompleter-insertcompletion.png
/usr/share/doc/qt6/qtwidgets/images/customsortfiltermodel-example.png
/usr/share/doc/qt6/qtwidgets/images/deform-demo.png
/usr/share/doc/qt6/qtwidgets/images/designer-stylesheet-options.png
/usr/share/doc/qt6/qtwidgets/images/designer-stylesheet-usage.png
/usr/share/doc/qt6/qtwidgets/images/designer-validator-highlighter.png
/usr/share/doc/qt6/qtwidgets/images/desktop-examples.png
/usr/share/doc/qt6/qtwidgets/images/diagramscene.png
/usr/share/doc/qt6/qtwidgets/images/dialog-examples.png
/usr/share/doc/qt6/qtwidgets/images/dockwidget.png
/usr/share/doc/qt6/qtwidgets/images/dockwidgetimage.png
/usr/share/doc/qt6/qtwidgets/images/dragdroprobot-example.png
/usr/share/doc/qt6/qtwidgets/images/draggableicons-example.png
/usr/share/doc/qt6/qtwidgets/images/draggabletext-example.png
/usr/share/doc/qt6/qtwidgets/images/dropsite-example.png
/usr/share/doc/qt6/qtwidgets/images/dummy_tree.png
/usr/share/doc/qt6/qtwidgets/images/easing-example.png
/usr/share/doc/qt6/qtwidgets/images/echopluginexample.png
/usr/share/doc/qt6/qtwidgets/images/elasticnodes-example.png
/usr/share/doc/qt6/qtwidgets/images/example_model.png
/usr/share/doc/qt6/qtwidgets/images/expanded_combobox.png
/usr/share/doc/qt6/qtwidgets/images/fetchmore-example.png
/usr/share/doc/qt6/qtwidgets/images/filedialogurls.png
/usr/share/doc/qt6/qtwidgets/images/flowlayout-example.png
/usr/share/doc/qt6/qtwidgets/images/frames.png
/usr/share/doc/qt6/qtwidgets/images/frozencolumn-example.png
/usr/share/doc/qt6/qtwidgets/images/frozencolumn-tableview.png
/usr/share/doc/qt6/qtwidgets/images/fusion-calendarwidget.png
/usr/share/doc/qt6/qtwidgets/images/fusion-colordialog.png
/usr/share/doc/qt6/qtwidgets/images/fusion-combobox.png
/usr/share/doc/qt6/qtwidgets/images/fusion-fontdialog.png
/usr/share/doc/qt6/qtwidgets/images/fusion-label.png
/usr/share/doc/qt6/qtwidgets/images/fusion-menu.png
/usr/share/doc/qt6/qtwidgets/images/fusion-progressdialog.png
/usr/share/doc/qt6/qtwidgets/images/fusion-pushbutton-menu.png
/usr/share/doc/qt6/qtwidgets/images/fusion-statusbar-sizegrip.png
/usr/share/doc/qt6/qtwidgets/images/fusion-style.png
/usr/share/doc/qt6/qtwidgets/images/fusion-tabbar-truncated.png
/usr/share/doc/qt6/qtwidgets/images/fusion-tabbar.png
/usr/share/doc/qt6/qtwidgets/images/fusion-tabwidget.png
/usr/share/doc/qt6/qtwidgets/images/geometry.png
/usr/share/doc/qt6/qtwidgets/images/gradients-demo.png
/usr/share/doc/qt6/qtwidgets/images/graphicseffect-blur.png
/usr/share/doc/qt6/qtwidgets/images/graphicseffect-colorize.png
/usr/share/doc/qt6/qtwidgets/images/graphicseffect-drop-shadow.png
/usr/share/doc/qt6/qtwidgets/images/graphicseffect-opacity.png
/usr/share/doc/qt6/qtwidgets/images/graphicseffect-plain.png
/usr/share/doc/qt6/qtwidgets/images/graphicseffect-widget.png
/usr/share/doc/qt6/qtwidgets/images/graphicssimpleanchorlayout-example.png
/usr/share/doc/qt6/qtwidgets/images/graphicsview-ellipseitem-pie.png
/usr/share/doc/qt6/qtwidgets/images/graphicsview-ellipseitem.png
/usr/share/doc/qt6/qtwidgets/images/graphicsview-examples.png
/usr/share/doc/qt6/qtwidgets/images/graphicsview-items.png
/usr/share/doc/qt6/qtwidgets/images/graphicsview-lineitem.png
/usr/share/doc/qt6/qtwidgets/images/graphicsview-parentchild.png
/usr/share/doc/qt6/qtwidgets/images/graphicsview-pathitem.png
/usr/share/doc/qt6/qtwidgets/images/graphicsview-pixmapitem.png
/usr/share/doc/qt6/qtwidgets/images/graphicsview-polygonitem.png
/usr/share/doc/qt6/qtwidgets/images/graphicsview-rectitem.png
/usr/share/doc/qt6/qtwidgets/images/graphicsview-simpletextitem.png
/usr/share/doc/qt6/qtwidgets/images/graphicsview-textitem.png
/usr/share/doc/qt6/qtwidgets/images/graphicsview-view.png
/usr/share/doc/qt6/qtwidgets/images/graphicsview-zorder.png
/usr/share/doc/qt6/qtwidgets/images/groupbox-example.png
/usr/share/doc/qt6/qtwidgets/images/groupbox.png
/usr/share/doc/qt6/qtwidgets/images/groupboximage.png
/usr/share/doc/qt6/qtwidgets/images/header.png
/usr/share/doc/qt6/qtwidgets/images/headerimage.png
/usr/share/doc/qt6/qtwidgets/images/home.png
/usr/share/doc/qt6/qtwidgets/images/ico_note.png
/usr/share/doc/qt6/qtwidgets/images/ico_note_attention.png
/usr/share/doc/qt6/qtwidgets/images/ico_out.png
/usr/share/doc/qt6/qtwidgets/images/imagecomposition-example.png
/usr/share/doc/qt6/qtwidgets/images/imagegestures-example.jpg
/usr/share/doc/qt6/qtwidgets/images/inputdialogs.png
/usr/share/doc/qt6/qtwidgets/images/itemviews-editabletreemodel-indexes.png
/usr/share/doc/qt6/qtwidgets/images/itemviews-editabletreemodel-items.png
/usr/share/doc/qt6/qtwidgets/images/itemviews-editabletreemodel-model.png
/usr/share/doc/qt6/qtwidgets/images/itemviews-editabletreemodel-values.png
/usr/share/doc/qt6/qtwidgets/images/itemviews-editabletreemodel.png
/usr/share/doc/qt6/qtwidgets/images/itemviews-examples.png
/usr/share/doc/qt6/qtwidgets/images/layout1.png
/usr/share/doc/qt6/qtwidgets/images/layout2.png
/usr/share/doc/qt6/qtwidgets/images/licensewizard-example.png
/usr/share/doc/qt6/qtwidgets/images/licensewizard-flow.png
/usr/share/doc/qt6/qtwidgets/images/lineedits-example.png
/usr/share/doc/qt6/qtwidgets/images/list_table_tree.png
/usr/share/doc/qt6/qtwidgets/images/listview.png
/usr/share/doc/qt6/qtwidgets/images/logo.png
/usr/share/doc/qt6/qtwidgets/images/macos-lineedit.png
/usr/share/doc/qt6/qtwidgets/images/macos-progressbar.png
/usr/share/doc/qt6/qtwidgets/images/macos-style.png
/usr/share/doc/qt6/qtwidgets/images/macos-style2.png
/usr/share/doc/qt6/qtwidgets/images/macos-tabwidget.png
/usr/share/doc/qt6/qtwidgets/images/mainwindow-docks-example.png
/usr/share/doc/qt6/qtwidgets/images/mainwindow-docks.png
/usr/share/doc/qt6/qtwidgets/images/mainwindow-examples.png
/usr/share/doc/qt6/qtwidgets/images/mainwindowlayout.png
/usr/share/doc/qt6/qtwidgets/images/mdi-cascade.png
/usr/share/doc/qt6/qtwidgets/images/mdi-tile.png
/usr/share/doc/qt6/qtwidgets/images/menu.png
/usr/share/doc/qt6/qtwidgets/images/menubar.png
/usr/share/doc/qt6/qtwidgets/images/menubarimage.png
/usr/share/doc/qt6/qtwidgets/images/menuimage.png
/usr/share/doc/qt6/qtwidgets/images/menus-example.png
/usr/share/doc/qt6/qtwidgets/images/modelview-combobox.png
/usr/share/doc/qt6/qtwidgets/images/modelview-header.png
/usr/share/doc/qt6/qtwidgets/images/modelview-models.png
/usr/share/doc/qt6/qtwidgets/images/modelview-overview.png
/usr/share/doc/qt6/qtwidgets/images/modelview-roles.png
/usr/share/doc/qt6/qtwidgets/images/modelview-tablemodel.png
/usr/share/doc/qt6/qtwidgets/images/modelview-treemodel.png
/usr/share/doc/qt6/qtwidgets/images/modelview.png
/usr/share/doc/qt6/qtwidgets/images/msgbox1.png
/usr/share/doc/qt6/qtwidgets/images/msgbox2.png
/usr/share/doc/qt6/qtwidgets/images/msgbox3.png
/usr/share/doc/qt6/qtwidgets/images/msgbox4.png
/usr/share/doc/qt6/qtwidgets/images/notepad1.png
/usr/share/doc/qt6/qtwidgets/images/notepad2.png
/usr/share/doc/qt6/qtwidgets/images/notepad3.png
/usr/share/doc/qt6/qtwidgets/images/notepad4.png
/usr/share/doc/qt6/qtwidgets/images/orderform-example-detailsdialog.png
/usr/share/doc/qt6/qtwidgets/images/orderform-example.png
/usr/share/doc/qt6/qtwidgets/images/painterpaths-example.png
/usr/share/doc/qt6/qtwidgets/images/painting-examples.png
/usr/share/doc/qt6/qtwidgets/images/paintsystem-icon.png
/usr/share/doc/qt6/qtwidgets/images/paintsystem-stylepainter.png
/usr/share/doc/qt6/qtwidgets/images/pangesture.png
/usr/share/doc/qt6/qtwidgets/images/parent-child-widgets.png
/usr/share/doc/qt6/qtwidgets/images/pathstroke-demo.png
/usr/share/doc/qt6/qtwidgets/images/pinchgesture.png
/usr/share/doc/qt6/qtwidgets/images/progressBar-stylesheet.png
/usr/share/doc/qt6/qtwidgets/images/progressBar2-stylesheet.png
/usr/share/doc/qt6/qtwidgets/images/progressbar.png
/usr/share/doc/qt6/qtwidgets/images/progressbarimage.png
/usr/share/doc/qt6/qtwidgets/images/propagation-custom.png
/usr/share/doc/qt6/qtwidgets/images/propagation-standard.png
/usr/share/doc/qt6/qtwidgets/images/pushbutton.png
/usr/share/doc/qt6/qtwidgets/images/qcalendarwidget-grid.png
/usr/share/doc/qt6/qtwidgets/images/qcalendarwidget-maximum.png
/usr/share/doc/qt6/qtwidgets/images/qcalendarwidget-minimum.png
/usr/share/doc/qt6/qtwidgets/images/qcolumnview.png
/usr/share/doc/qt6/qtwidgets/images/qcompleter.png
/usr/share/doc/qt6/qtwidgets/images/qerrormessage.png
/usr/share/doc/qt6/qtwidgets/images/qformlayout-kde.png
/usr/share/doc/qt6/qtwidgets/images/qformlayout-mac.png
/usr/share/doc/qt6/qtwidgets/images/qformlayout-qpe.png
/usr/share/doc/qt6/qtwidgets/images/qformlayout-win.png
/usr/share/doc/qt6/qtwidgets/images/qformlayout-with-6-children.png
/usr/share/doc/qt6/qtwidgets/images/qgraphicsproxywidget-embed.png
/usr/share/doc/qt6/qtwidgets/images/qgridlayout-with-5-children.png
/usr/share/doc/qt6/qtwidgets/images/qgridlayout.png
/usr/share/doc/qt6/qtwidgets/images/qhboxlayout-with-5-children.png
/usr/share/doc/qt6/qtwidgets/images/qmdisubwindowlayout.png
/usr/share/doc/qt6/qtwidgets/images/qmessagebox-crit.png
/usr/share/doc/qt6/qtwidgets/images/qmessagebox-info.png
/usr/share/doc/qt6/qtwidgets/images/qmessagebox-quest.png
/usr/share/doc/qt6/qtwidgets/images/qmessagebox-warn.png
/usr/share/doc/qt6/qtwidgets/images/qscrollarea-noscrollbars.png
/usr/share/doc/qt6/qtwidgets/images/qscrollarea-onescrollbar.png
/usr/share/doc/qt6/qtwidgets/images/qscrollarea-twoscrollbars.png
/usr/share/doc/qt6/qtwidgets/images/qscrollbar-picture.png
/usr/share/doc/qt6/qtwidgets/images/qscrollbar-values.png
/usr/share/doc/qt6/qtwidgets/images/qspinbox-plusminus.png
/usr/share/doc/qt6/qtwidgets/images/qspinbox-updown.png
/usr/share/doc/qt6/qtwidgets/images/qstyle-comboboxes.png
/usr/share/doc/qt6/qtwidgets/images/qstyleoptiontoolbar-position.png
/usr/share/doc/qt6/qtwidgets/images/qtableview-resized.png
/usr/share/doc/qt6/qtwidgets/images/qtwizard-aero1.png
/usr/share/doc/qt6/qtwidgets/images/qtwizard-aero2.png
/usr/share/doc/qt6/qtwidgets/images/qtwizard-classic1.png
/usr/share/doc/qt6/qtwidgets/images/qtwizard-classic2.png
/usr/share/doc/qt6/qtwidgets/images/qtwizard-mac1.png
/usr/share/doc/qt6/qtwidgets/images/qtwizard-mac2.png
/usr/share/doc/qt6/qtwidgets/images/qtwizard-macpage.png
/usr/share/doc/qt6/qtwidgets/images/qtwizard-modern1.png
/usr/share/doc/qt6/qtwidgets/images/qtwizard-modern2.png
/usr/share/doc/qt6/qtwidgets/images/qtwizard-nonmacpage.png
/usr/share/doc/qt6/qtwidgets/images/qundoview.png
/usr/share/doc/qt6/qtwidgets/images/qvboxlayout-with-5-children.png
/usr/share/doc/qt6/qtwidgets/images/readonlytable_role.png
/usr/share/doc/qt6/qtwidgets/images/regularexpression-example.png
/usr/share/doc/qt6/qtwidgets/images/richtext-examples.png
/usr/share/doc/qt6/qtwidgets/images/rubberband.png
/usr/share/doc/qt6/qtwidgets/images/rubberbandimage.png
/usr/share/doc/qt6/qtwidgets/images/screenshot-example.png
/usr/share/doc/qt6/qtwidgets/images/scribble-example.png
/usr/share/doc/qt6/qtwidgets/images/scrollbar.png
/usr/share/doc/qt6/qtwidgets/images/scrollbarimage.png
/usr/share/doc/qt6/qtwidgets/images/selected-items1.png
/usr/share/doc/qt6/qtwidgets/images/selected-items2.png
/usr/share/doc/qt6/qtwidgets/images/selected-items3.png
/usr/share/doc/qt6/qtwidgets/images/selection-extended.png
/usr/share/doc/qt6/qtwidgets/images/selection-multi.png
/usr/share/doc/qt6/qtwidgets/images/selection-single.png
/usr/share/doc/qt6/qtwidgets/images/selection2.png
/usr/share/doc/qt6/qtwidgets/images/settingseditor-example.png
/usr/share/doc/qt6/qtwidgets/images/shapedclock-dragging.png
/usr/share/doc/qt6/qtwidgets/images/shapedclock-example.png
/usr/share/doc/qt6/qtwidgets/images/shareddirmodel.png
/usr/share/doc/qt6/qtwidgets/images/sharedmodel-tableviews.png
/usr/share/doc/qt6/qtwidgets/images/sharedselection-tableviews.png
/usr/share/doc/qt6/qtwidgets/images/shortcuteditor-example.png
/usr/share/doc/qt6/qtwidgets/images/signals-n-slots-aw-nat.png
/usr/share/doc/qt6/qtwidgets/images/simpleanchorlayout-example.png
/usr/share/doc/qt6/qtwidgets/images/simpletreemodel-example.png
/usr/share/doc/qt6/qtwidgets/images/sizegrip.png
/usr/share/doc/qt6/qtwidgets/images/sizegripimage.png
/usr/share/doc/qt6/qtwidgets/images/slider.png
/usr/share/doc/qt6/qtwidgets/images/sliderimage.png
/usr/share/doc/qt6/qtwidgets/images/sliders-example.png
/usr/share/doc/qt6/qtwidgets/images/spinbox.png
/usr/share/doc/qt6/qtwidgets/images/spinboxdelegate-example.png
/usr/share/doc/qt6/qtwidgets/images/spinboxes-example.png
/usr/share/doc/qt6/qtwidgets/images/spinboximage.png
/usr/share/doc/qt6/qtwidgets/images/spreadsheet-demo.png
/usr/share/doc/qt6/qtwidgets/images/standard-views.png
/usr/share/doc/qt6/qtwidgets/images/standarddialogs-example.png
/usr/share/doc/qt6/qtwidgets/images/standardwidget.png
/usr/share/doc/qt6/qtwidgets/images/stardelegate.png
/usr/share/doc/qt6/qtwidgets/images/stringlistmodel.png
/usr/share/doc/qt6/qtwidgets/images/stylepluginexample.png
/usr/share/doc/qt6/qtwidgets/images/stylesheet-border-image-normal.png
/usr/share/doc/qt6/qtwidgets/images/stylesheet-border-image-stretched.png
/usr/share/doc/qt6/qtwidgets/images/stylesheet-border-image-wrong.png
/usr/share/doc/qt6/qtwidgets/images/stylesheet-boxmodel.png
/usr/share/doc/qt6/qtwidgets/images/stylesheet-branch-closed.png
/usr/share/doc/qt6/qtwidgets/images/stylesheet-branch-end.png
/usr/share/doc/qt6/qtwidgets/images/stylesheet-branch-more.png
/usr/share/doc/qt6/qtwidgets/images/stylesheet-branch-open.png
/usr/share/doc/qt6/qtwidgets/images/stylesheet-redbutton1.png
/usr/share/doc/qt6/qtwidgets/images/stylesheet-redbutton2.png
/usr/share/doc/qt6/qtwidgets/images/stylesheet-redbutton3.png
/usr/share/doc/qt6/qtwidgets/images/stylesheet-scrollbar1.png
/usr/share/doc/qt6/qtwidgets/images/stylesheet-scrollbar2.png
/usr/share/doc/qt6/qtwidgets/images/stylesheet-treeview.png
/usr/share/doc/qt6/qtwidgets/images/stylesheet-vline.png
/usr/share/doc/qt6/qtwidgets/images/swipegesture.png
/usr/share/doc/qt6/qtwidgets/images/syntaxhighlighter-example.png
/usr/share/doc/qt6/qtwidgets/images/system-tray.webp
/usr/share/doc/qt6/qtwidgets/images/systemtray-editor.png
/usr/share/doc/qt6/qtwidgets/images/systemtray-example.png
/usr/share/doc/qt6/qtwidgets/images/tab.png
/usr/share/doc/qt6/qtwidgets/images/tabWidget-stylesheet1.png
/usr/share/doc/qt6/qtwidgets/images/tabWidget-stylesheet2.png
/usr/share/doc/qt6/qtwidgets/images/tabWidget-stylesheet3.png
/usr/share/doc/qt6/qtwidgets/images/tabdialog-example.png
/usr/share/doc/qt6/qtwidgets/images/tableWidget-stylesheet.png
/usr/share/doc/qt6/qtwidgets/images/tabletexample.png
/usr/share/doc/qt6/qtwidgets/images/tableview.png
/usr/share/doc/qt6/qtwidgets/images/tabwidget.png
/usr/share/doc/qt6/qtwidgets/images/titlebar.png
/usr/share/doc/qt6/qtwidgets/images/titlebarimage.png
/usr/share/doc/qt6/qtwidgets/images/toolbar.png
/usr/share/doc/qt6/qtwidgets/images/toolbarimage.png
/usr/share/doc/qt6/qtwidgets/images/toolbox.png
/usr/share/doc/qt6/qtwidgets/images/toolboximage.png
/usr/share/doc/qt6/qtwidgets/images/toolbutton.png
/usr/share/doc/qt6/qtwidgets/images/toolbuttonimage.png
/usr/share/doc/qt6/qtwidgets/images/touch-knobs-example.png
/usr/share/doc/qt6/qtwidgets/images/transformations-example.png
/usr/share/doc/qt6/qtwidgets/images/tree_2_with_algorithm.png
/usr/share/doc/qt6/qtwidgets/images/treemodel-structure.png
/usr/share/doc/qt6/qtwidgets/images/treemodelcompleter-example.png
/usr/share/doc/qt6/qtwidgets/images/treeview.png
/usr/share/doc/qt6/qtwidgets/images/trivialwizard-example-conclusion.png
/usr/share/doc/qt6/qtwidgets/images/trivialwizard-example-flow.png
/usr/share/doc/qt6/qtwidgets/images/trivialwizard-example-introduction.png
/usr/share/doc/qt6/qtwidgets/images/trivialwizard-example-registration.png
/usr/share/doc/qt6/qtwidgets/images/undoframeworkexample.png
/usr/share/doc/qt6/qtwidgets/images/whatsthis.png
/usr/share/doc/qt6/qtwidgets/images/widget-examples.png
/usr/share/doc/qt6/qtwidgets/images/widgetdelegate.png
/usr/share/doc/qt6/qtwidgets/images/widgetmapper-combo-mapping.png
/usr/share/doc/qt6/qtwidgets/images/widgetmapper.png
/usr/share/doc/qt6/qtwidgets/images/widgets-tutorial-childwidget.png
/usr/share/doc/qt6/qtwidgets/images/widgets-tutorial-nestedlayouts.png
/usr/share/doc/qt6/qtwidgets/images/widgets-tutorial-toplevel.png
/usr/share/doc/qt6/qtwidgets/images/widgets-tutorial-windowlayout.png
/usr/share/doc/qt6/qtwidgets/images/windowflags-example.png
/usr/share/doc/qt6/qtwidgets/images/windowflags_controllerwindow.png
/usr/share/doc/qt6/qtwidgets/images/windowflags_previewwindow.png
/usr/share/doc/qt6/qtwidgets/images/windows-checkbox.png
/usr/share/doc/qt6/qtwidgets/images/windows-dateedit.png
/usr/share/doc/qt6/qtwidgets/images/windows-datetimeedit.png
/usr/share/doc/qt6/qtwidgets/images/windows-dial.png
/usr/share/doc/qt6/qtwidgets/images/windows-groupbox.png
/usr/share/doc/qt6/qtwidgets/images/windows-label.png
/usr/share/doc/qt6/qtwidgets/images/windows-lcdnumber.png
/usr/share/doc/qt6/qtwidgets/images/windows-lineedit.png
/usr/share/doc/qt6/qtwidgets/images/windows-listview.png
/usr/share/doc/qt6/qtwidgets/images/windows-progressbar.png
/usr/share/doc/qt6/qtwidgets/images/windows-pushbutton.png
/usr/share/doc/qt6/qtwidgets/images/windows-radiobutton.png
/usr/share/doc/qt6/qtwidgets/images/windows-slider.png
/usr/share/doc/qt6/qtwidgets/images/windows-spinbox.png
/usr/share/doc/qt6/qtwidgets/images/windows-style.png
/usr/share/doc/qt6/qtwidgets/images/windows-style2.png
/usr/share/doc/qt6/qtwidgets/images/windows-tableview.png
/usr/share/doc/qt6/qtwidgets/images/windows-tabwidget.png
/usr/share/doc/qt6/qtwidgets/images/windows-timeedit.png
/usr/share/doc/qt6/qtwidgets/images/windows-treeview.png
/usr/share/doc/qt6/qtwidgets/images/windows-vista-style.png
/usr/share/doc/qt6/qtwidgets/images/windowstabimage.png
/usr/share/doc/qt6/qtwidgets/images/windowsvista-fontcombobox.png
/usr/share/doc/qt6/qtwidgets/images/windowsvista-pushbutton.png
/usr/share/doc/qt6/qtwidgets/images/windowsvista-radiobutton.png
/usr/share/doc/qt6/qtwidgets/images/windowsvista-tabwidget.png
/usr/share/doc/qt6/qtwidgets/layout.html
/usr/share/doc/qt6/qtwidgets/mainwindow.html
/usr/share/doc/qt6/qtwidgets/model-view-programming.html
/usr/share/doc/qt6/qtwidgets/modelview-part2-main-cpp.html
/usr/share/doc/qt6/qtwidgets/modelview.html
/usr/share/doc/qt6/qtwidgets/qabstractbutton-members.html
/usr/share/doc/qt6/qtwidgets/qabstractbutton.html
/usr/share/doc/qt6/qtwidgets/qabstractgraphicsshapeitem-members.html
/usr/share/doc/qt6/qtwidgets/qabstractgraphicsshapeitem.html
/usr/share/doc/qt6/qtwidgets/qabstractitemdelegate-members.html
/usr/share/doc/qt6/qtwidgets/qabstractitemdelegate.html
/usr/share/doc/qt6/qtwidgets/qabstractitemview-members.html
/usr/share/doc/qt6/qtwidgets/qabstractitemview-obsolete.html
/usr/share/doc/qt6/qtwidgets/qabstractitemview.html
/usr/share/doc/qt6/qtwidgets/qabstractscrollarea-members.html
/usr/share/doc/qt6/qtwidgets/qabstractscrollarea.html
/usr/share/doc/qt6/qtwidgets/qabstractslider-members.html
/usr/share/doc/qt6/qtwidgets/qabstractslider.html
/usr/share/doc/qt6/qtwidgets/qabstractspinbox-members.html
/usr/share/doc/qt6/qtwidgets/qabstractspinbox.html
/usr/share/doc/qt6/qtwidgets/qaccessiblewidget-members.html
/usr/share/doc/qt6/qtwidgets/qaccessiblewidget.html
/usr/share/doc/qt6/qtwidgets/qapplication-members.html
/usr/share/doc/qt6/qtwidgets/qapplication-obsolete.html
/usr/share/doc/qt6/qtwidgets/qapplication.html
/usr/share/doc/qt6/qtwidgets/qboxlayout-members.html
/usr/share/doc/qt6/qtwidgets/qboxlayout.html
/usr/share/doc/qt6/qtwidgets/qbuttongroup-members.html
/usr/share/doc/qt6/qtwidgets/qbuttongroup.html
/usr/share/doc/qt6/qtwidgets/qcalendarwidget-members.html
/usr/share/doc/qt6/qtwidgets/qcalendarwidget.html
/usr/share/doc/qt6/qtwidgets/qcheckbox-members.html
/usr/share/doc/qt6/qtwidgets/qcheckbox.html
/usr/share/doc/qt6/qtwidgets/qcolordialog-members.html
/usr/share/doc/qt6/qtwidgets/qcolordialog.html
/usr/share/doc/qt6/qtwidgets/qcolormap-members.html
/usr/share/doc/qt6/qtwidgets/qcolormap.html
/usr/share/doc/qt6/qtwidgets/qcolumnview-members.html
/usr/share/doc/qt6/qtwidgets/qcolumnview.html
/usr/share/doc/qt6/qtwidgets/qcombobox-members.html
/usr/share/doc/qt6/qtwidgets/qcombobox.html
/usr/share/doc/qt6/qtwidgets/qcommandlinkbutton-members.html
/usr/share/doc/qt6/qtwidgets/qcommandlinkbutton.html
/usr/share/doc/qt6/qtwidgets/qcommonstyle-members.html
/usr/share/doc/qt6/qtwidgets/qcommonstyle.html
/usr/share/doc/qt6/qtwidgets/qcompleter-members.html
/usr/share/doc/qt6/qtwidgets/qcompleter.html
/usr/share/doc/qt6/qtwidgets/qdatawidgetmapper-members.html
/usr/share/doc/qt6/qtwidgets/qdatawidgetmapper.html
/usr/share/doc/qt6/qtwidgets/qdateedit-members.html
/usr/share/doc/qt6/qtwidgets/qdateedit.html
/usr/share/doc/qt6/qtwidgets/qdatetimeedit-members.html
/usr/share/doc/qt6/qtwidgets/qdatetimeedit.html
/usr/share/doc/qt6/qtwidgets/qdial-members.html
/usr/share/doc/qt6/qtwidgets/qdial.html
/usr/share/doc/qt6/qtwidgets/qdialog-members.html
/usr/share/doc/qt6/qtwidgets/qdialog.html
/usr/share/doc/qt6/qtwidgets/qdialogbuttonbox-members.html
/usr/share/doc/qt6/qtwidgets/qdialogbuttonbox.html
/usr/share/doc/qt6/qtwidgets/qdockwidget-members.html
/usr/share/doc/qt6/qtwidgets/qdockwidget.html
/usr/share/doc/qt6/qtwidgets/qdoublespinbox-members.html
/usr/share/doc/qt6/qtwidgets/qdoublespinbox.html
/usr/share/doc/qt6/qtwidgets/qdrawutil-h.html
/usr/share/doc/qt6/qtwidgets/qerrormessage-members.html
/usr/share/doc/qt6/qtwidgets/qerrormessage.html
/usr/share/doc/qt6/qtwidgets/qfiledialog-members.html
/usr/share/doc/qt6/qtwidgets/qfiledialog.html
/usr/share/doc/qt6/qtwidgets/qfileiconprovider-members.html
/usr/share/doc/qt6/qtwidgets/qfileiconprovider.html
/usr/share/doc/qt6/qtwidgets/qfocusframe-members.html
/usr/share/doc/qt6/qtwidgets/qfocusframe.html
/usr/share/doc/qt6/qtwidgets/qfontcombobox-members.html
/usr/share/doc/qt6/qtwidgets/qfontcombobox.html
/usr/share/doc/qt6/qtwidgets/qfontdialog-members.html
/usr/share/doc/qt6/qtwidgets/qfontdialog.html
/usr/share/doc/qt6/qtwidgets/qformlayout-members.html
/usr/share/doc/qt6/qtwidgets/qformlayout-takerowresult-members.html
/usr/share/doc/qt6/qtwidgets/qformlayout-takerowresult.html
/usr/share/doc/qt6/qtwidgets/qformlayout.html
/usr/share/doc/qt6/qtwidgets/qframe-members.html
/usr/share/doc/qt6/qtwidgets/qframe.html
/usr/share/doc/qt6/qtwidgets/qgesture-members.html
/usr/share/doc/qt6/qtwidgets/qgesture.html
/usr/share/doc/qt6/qtwidgets/qgestureevent-members.html
/usr/share/doc/qt6/qtwidgets/qgestureevent.html
/usr/share/doc/qt6/qtwidgets/qgesturerecognizer-members.html
/usr/share/doc/qt6/qtwidgets/qgesturerecognizer.html
/usr/share/doc/qt6/qtwidgets/qgraphicsanchor-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicsanchor.html
/usr/share/doc/qt6/qtwidgets/qgraphicsanchorlayout-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicsanchorlayout.html
/usr/share/doc/qt6/qtwidgets/qgraphicsblureffect-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicsblureffect.html
/usr/share/doc/qt6/qtwidgets/qgraphicscolorizeeffect-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicscolorizeeffect.html
/usr/share/doc/qt6/qtwidgets/qgraphicsdropshadoweffect-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicsdropshadoweffect.html
/usr/share/doc/qt6/qtwidgets/qgraphicseffect-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicseffect.html
/usr/share/doc/qt6/qtwidgets/qgraphicsellipseitem-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicsellipseitem.html
/usr/share/doc/qt6/qtwidgets/qgraphicsgridlayout-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicsgridlayout.html
/usr/share/doc/qt6/qtwidgets/qgraphicsitem-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicsitem-obsolete.html
/usr/share/doc/qt6/qtwidgets/qgraphicsitem.html
/usr/share/doc/qt6/qtwidgets/qgraphicsitemanimation-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicsitemanimation.html
/usr/share/doc/qt6/qtwidgets/qgraphicsitemgroup-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicsitemgroup.html
/usr/share/doc/qt6/qtwidgets/qgraphicslayout-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicslayout.html
/usr/share/doc/qt6/qtwidgets/qgraphicslayoutitem-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicslayoutitem.html
/usr/share/doc/qt6/qtwidgets/qgraphicslinearlayout-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicslinearlayout.html
/usr/share/doc/qt6/qtwidgets/qgraphicslineitem-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicslineitem.html
/usr/share/doc/qt6/qtwidgets/qgraphicsobject-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicsobject.html
/usr/share/doc/qt6/qtwidgets/qgraphicsopacityeffect-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicsopacityeffect.html
/usr/share/doc/qt6/qtwidgets/qgraphicspathitem-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicspathitem.html
/usr/share/doc/qt6/qtwidgets/qgraphicspixmapitem-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicspixmapitem.html
/usr/share/doc/qt6/qtwidgets/qgraphicspolygonitem-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicspolygonitem.html
/usr/share/doc/qt6/qtwidgets/qgraphicsproxywidget-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicsproxywidget.html
/usr/share/doc/qt6/qtwidgets/qgraphicsrectitem-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicsrectitem.html
/usr/share/doc/qt6/qtwidgets/qgraphicsrotation-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicsrotation.html
/usr/share/doc/qt6/qtwidgets/qgraphicsscale-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicsscale.html
/usr/share/doc/qt6/qtwidgets/qgraphicsscene-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicsscene-obsolete.html
/usr/share/doc/qt6/qtwidgets/qgraphicsscene.html
/usr/share/doc/qt6/qtwidgets/qgraphicsscenecontextmenuevent-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicsscenecontextmenuevent.html
/usr/share/doc/qt6/qtwidgets/qgraphicsscenedragdropevent-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicsscenedragdropevent.html
/usr/share/doc/qt6/qtwidgets/qgraphicssceneevent-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicssceneevent.html
/usr/share/doc/qt6/qtwidgets/qgraphicsscenehelpevent-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicsscenehelpevent.html
/usr/share/doc/qt6/qtwidgets/qgraphicsscenehoverevent-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicsscenehoverevent.html
/usr/share/doc/qt6/qtwidgets/qgraphicsscenemouseevent-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicsscenemouseevent.html
/usr/share/doc/qt6/qtwidgets/qgraphicsscenemoveevent-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicsscenemoveevent.html
/usr/share/doc/qt6/qtwidgets/qgraphicssceneresizeevent-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicssceneresizeevent.html
/usr/share/doc/qt6/qtwidgets/qgraphicsscenewheelevent-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicsscenewheelevent.html
/usr/share/doc/qt6/qtwidgets/qgraphicssimpletextitem-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicssimpletextitem.html
/usr/share/doc/qt6/qtwidgets/qgraphicstextitem-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicstextitem.html
/usr/share/doc/qt6/qtwidgets/qgraphicstransform-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicstransform.html
/usr/share/doc/qt6/qtwidgets/qgraphicsview-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicsview-obsolete.html
/usr/share/doc/qt6/qtwidgets/qgraphicsview.html
/usr/share/doc/qt6/qtwidgets/qgraphicswidget-members.html
/usr/share/doc/qt6/qtwidgets/qgraphicswidget.html
/usr/share/doc/qt6/qtwidgets/qgridlayout-members.html
/usr/share/doc/qt6/qtwidgets/qgridlayout.html
/usr/share/doc/qt6/qtwidgets/qgroupbox-members.html
/usr/share/doc/qt6/qtwidgets/qgroupbox.html
/usr/share/doc/qt6/qtwidgets/qhboxlayout-members.html
/usr/share/doc/qt6/qtwidgets/qhboxlayout.html
/usr/share/doc/qt6/qtwidgets/qheaderview-members.html
/usr/share/doc/qt6/qtwidgets/qheaderview.html
/usr/share/doc/qt6/qtwidgets/qinputdialog-members.html
/usr/share/doc/qt6/qtwidgets/qinputdialog.html
/usr/share/doc/qt6/qtwidgets/qitemdelegate-members.html
/usr/share/doc/qt6/qtwidgets/qitemdelegate.html
/usr/share/doc/qt6/qtwidgets/qitemeditorcreator-members.html
/usr/share/doc/qt6/qtwidgets/qitemeditorcreator.html
/usr/share/doc/qt6/qtwidgets/qitemeditorcreatorbase-members.html
/usr/share/doc/qt6/qtwidgets/qitemeditorcreatorbase.html
/usr/share/doc/qt6/qtwidgets/qitemeditorfactory-members.html
/usr/share/doc/qt6/qtwidgets/qitemeditorfactory.html
/usr/share/doc/qt6/qtwidgets/qkeysequenceedit-members.html
/usr/share/doc/qt6/qtwidgets/qkeysequenceedit.html
/usr/share/doc/qt6/qtwidgets/qlabel-members.html
/usr/share/doc/qt6/qtwidgets/qlabel-obsolete.html
/usr/share/doc/qt6/qtwidgets/qlabel.html
/usr/share/doc/qt6/qtwidgets/qlayout-members.html
/usr/share/doc/qt6/qtwidgets/qlayout.html
/usr/share/doc/qt6/qtwidgets/qlayoutitem-members.html
/usr/share/doc/qt6/qtwidgets/qlayoutitem.html
/usr/share/doc/qt6/qtwidgets/qlcdnumber-members.html
/usr/share/doc/qt6/qtwidgets/qlcdnumber.html
/usr/share/doc/qt6/qtwidgets/qlineedit-members.html
/usr/share/doc/qt6/qtwidgets/qlineedit.html
/usr/share/doc/qt6/qtwidgets/qlistview-members.html
/usr/share/doc/qt6/qtwidgets/qlistview.html
/usr/share/doc/qt6/qtwidgets/qlistwidget-members.html
/usr/share/doc/qt6/qtwidgets/qlistwidget.html
/usr/share/doc/qt6/qtwidgets/qlistwidgetitem-members.html
/usr/share/doc/qt6/qtwidgets/qlistwidgetitem-obsolete.html
/usr/share/doc/qt6/qtwidgets/qlistwidgetitem.html
/usr/share/doc/qt6/qtwidgets/qmainwindow-members.html
/usr/share/doc/qt6/qtwidgets/qmainwindow.html
/usr/share/doc/qt6/qtwidgets/qmdiarea-members.html
/usr/share/doc/qt6/qtwidgets/qmdiarea.html
/usr/share/doc/qt6/qtwidgets/qmdisubwindow-members.html
/usr/share/doc/qt6/qtwidgets/qmdisubwindow.html
/usr/share/doc/qt6/qtwidgets/qmenu-members.html
/usr/share/doc/qt6/qtwidgets/qmenu-obsolete.html
/usr/share/doc/qt6/qtwidgets/qmenu.html
/usr/share/doc/qt6/qtwidgets/qmenubar-members.html
/usr/share/doc/qt6/qtwidgets/qmenubar.html
/usr/share/doc/qt6/qtwidgets/qmessagebox-members.html
/usr/share/doc/qt6/qtwidgets/qmessagebox-obsolete.html
/usr/share/doc/qt6/qtwidgets/qmessagebox.html
/usr/share/doc/qt6/qtwidgets/qpangesture-members.html
/usr/share/doc/qt6/qtwidgets/qpangesture.html
/usr/share/doc/qt6/qtwidgets/qpinchgesture-members.html
/usr/share/doc/qt6/qtwidgets/qpinchgesture.html
/usr/share/doc/qt6/qtwidgets/qplaintextdocumentlayout-members.html
/usr/share/doc/qt6/qtwidgets/qplaintextdocumentlayout.html
/usr/share/doc/qt6/qtwidgets/qplaintextedit-members.html
/usr/share/doc/qt6/qtwidgets/qplaintextedit.html
/usr/share/doc/qt6/qtwidgets/qprogressbar-members.html
/usr/share/doc/qt6/qtwidgets/qprogressbar.html
/usr/share/doc/qt6/qtwidgets/qprogressdialog-members.html
/usr/share/doc/qt6/qtwidgets/qprogressdialog.html
/usr/share/doc/qt6/qtwidgets/qproxystyle-members.html
/usr/share/doc/qt6/qtwidgets/qproxystyle.html
/usr/share/doc/qt6/qtwidgets/qpushbutton-members.html
/usr/share/doc/qt6/qtwidgets/qpushbutton.html
/usr/share/doc/qt6/qtwidgets/qradiobutton-members.html
/usr/share/doc/qt6/qtwidgets/qradiobutton.html
/usr/share/doc/qt6/qtwidgets/qrubberband-members.html
/usr/share/doc/qt6/qtwidgets/qrubberband.html
/usr/share/doc/qt6/qtwidgets/qscrollarea-members.html
/usr/share/doc/qt6/qtwidgets/qscrollarea.html
/usr/share/doc/qt6/qtwidgets/qscrollbar-members.html
/usr/share/doc/qt6/qtwidgets/qscrollbar.html
/usr/share/doc/qt6/qtwidgets/qscroller-members.html
/usr/share/doc/qt6/qtwidgets/qscroller.html
/usr/share/doc/qt6/qtwidgets/qscrollerproperties-members.html
/usr/share/doc/qt6/qtwidgets/qscrollerproperties.html
/usr/share/doc/qt6/qtwidgets/qsizegrip-members.html
/usr/share/doc/qt6/qtwidgets/qsizegrip.html
/usr/share/doc/qt6/qtwidgets/qsizepolicy-members.html
/usr/share/doc/qt6/qtwidgets/qsizepolicy.html
/usr/share/doc/qt6/qtwidgets/qslider-members.html
/usr/share/doc/qt6/qtwidgets/qslider.html
/usr/share/doc/qt6/qtwidgets/qspaceritem-members.html
/usr/share/doc/qt6/qtwidgets/qspaceritem.html
/usr/share/doc/qt6/qtwidgets/qspinbox-members.html
/usr/share/doc/qt6/qtwidgets/qspinbox.html
/usr/share/doc/qt6/qtwidgets/qsplashscreen-members.html
/usr/share/doc/qt6/qtwidgets/qsplashscreen.html
/usr/share/doc/qt6/qtwidgets/qsplitter-members.html
/usr/share/doc/qt6/qtwidgets/qsplitter.html
/usr/share/doc/qt6/qtwidgets/qsplitterhandle-members.html
/usr/share/doc/qt6/qtwidgets/qsplitterhandle.html
/usr/share/doc/qt6/qtwidgets/qstackedlayout-members.html
/usr/share/doc/qt6/qtwidgets/qstackedlayout.html
/usr/share/doc/qt6/qtwidgets/qstackedwidget-members.html
/usr/share/doc/qt6/qtwidgets/qstackedwidget.html
/usr/share/doc/qt6/qtwidgets/qstandarditemeditorcreator-members.html
/usr/share/doc/qt6/qtwidgets/qstandarditemeditorcreator.html
/usr/share/doc/qt6/qtwidgets/qstatusbar-members.html
/usr/share/doc/qt6/qtwidgets/qstatusbar.html
/usr/share/doc/qt6/qtwidgets/qstyle-members.html
/usr/share/doc/qt6/qtwidgets/qstyle-obsolete.html
/usr/share/doc/qt6/qtwidgets/qstyle.html
/usr/share/doc/qt6/qtwidgets/qstyleditemdelegate-members.html
/usr/share/doc/qt6/qtwidgets/qstyleditemdelegate.html
/usr/share/doc/qt6/qtwidgets/qstylefactory-members.html
/usr/share/doc/qt6/qtwidgets/qstylefactory.html
/usr/share/doc/qt6/qtwidgets/qstylehintreturn-members.html
/usr/share/doc/qt6/qtwidgets/qstylehintreturn.html
/usr/share/doc/qt6/qtwidgets/qstylehintreturnmask-members.html
/usr/share/doc/qt6/qtwidgets/qstylehintreturnmask.html
/usr/share/doc/qt6/qtwidgets/qstylehintreturnvariant-members.html
/usr/share/doc/qt6/qtwidgets/qstylehintreturnvariant.html
/usr/share/doc/qt6/qtwidgets/qstyleoption-members.html
/usr/share/doc/qt6/qtwidgets/qstyleoption.html
/usr/share/doc/qt6/qtwidgets/qstyleoptionbutton-members.html
/usr/share/doc/qt6/qtwidgets/qstyleoptionbutton.html
/usr/share/doc/qt6/qtwidgets/qstyleoptioncombobox-members.html
/usr/share/doc/qt6/qtwidgets/qstyleoptioncombobox.html
/usr/share/doc/qt6/qtwidgets/qstyleoptioncomplex-members.html
/usr/share/doc/qt6/qtwidgets/qstyleoptioncomplex.html
/usr/share/doc/qt6/qtwidgets/qstyleoptiondockwidget-members.html
/usr/share/doc/qt6/qtwidgets/qstyleoptiondockwidget.html
/usr/share/doc/qt6/qtwidgets/qstyleoptionfocusrect-members.html
/usr/share/doc/qt6/qtwidgets/qstyleoptionfocusrect.html
/usr/share/doc/qt6/qtwidgets/qstyleoptionframe-members.html
/usr/share/doc/qt6/qtwidgets/qstyleoptionframe.html
/usr/share/doc/qt6/qtwidgets/qstyleoptiongraphicsitem-members.html
/usr/share/doc/qt6/qtwidgets/qstyleoptiongraphicsitem.html
/usr/share/doc/qt6/qtwidgets/qstyleoptiongroupbox-members.html
/usr/share/doc/qt6/qtwidgets/qstyleoptiongroupbox.html
/usr/share/doc/qt6/qtwidgets/qstyleoptionheader-members.html
/usr/share/doc/qt6/qtwidgets/qstyleoptionheader.html
/usr/share/doc/qt6/qtwidgets/qstyleoptionheaderv2-members.html
/usr/share/doc/qt6/qtwidgets/qstyleoptionheaderv2.html
/usr/share/doc/qt6/qtwidgets/qstyleoptionmenuitem-members.html
/usr/share/doc/qt6/qtwidgets/qstyleoptionmenuitem.html
/usr/share/doc/qt6/qtwidgets/qstyleoptionprogressbar-members.html
/usr/share/doc/qt6/qtwidgets/qstyleoptionprogressbar.html
/usr/share/doc/qt6/qtwidgets/qstyleoptionrubberband-members.html
/usr/share/doc/qt6/qtwidgets/qstyleoptionrubberband.html
/usr/share/doc/qt6/qtwidgets/qstyleoptionsizegrip-members.html
/usr/share/doc/qt6/qtwidgets/qstyleoptionsizegrip.html
/usr/share/doc/qt6/qtwidgets/qstyleoptionslider-members.html
/usr/share/doc/qt6/qtwidgets/qstyleoptionslider.html
/usr/share/doc/qt6/qtwidgets/qstyleoptionspinbox-members.html
/usr/share/doc/qt6/qtwidgets/qstyleoptionspinbox.html
/usr/share/doc/qt6/qtwidgets/qstyleoptiontab-members.html
/usr/share/doc/qt6/qtwidgets/qstyleoptiontab.html
/usr/share/doc/qt6/qtwidgets/qstyleoptiontabbarbase-members.html
/usr/share/doc/qt6/qtwidgets/qstyleoptiontabbarbase.html
/usr/share/doc/qt6/qtwidgets/qstyleoptiontabwidgetframe-members.html
/usr/share/doc/qt6/qtwidgets/qstyleoptiontabwidgetframe.html
/usr/share/doc/qt6/qtwidgets/qstyleoptiontitlebar-members.html
/usr/share/doc/qt6/qtwidgets/qstyleoptiontitlebar.html
/usr/share/doc/qt6/qtwidgets/qstyleoptiontoolbar-members.html
/usr/share/doc/qt6/qtwidgets/qstyleoptiontoolbar.html
/usr/share/doc/qt6/qtwidgets/qstyleoptiontoolbox-members.html
/usr/share/doc/qt6/qtwidgets/qstyleoptiontoolbox.html
/usr/share/doc/qt6/qtwidgets/qstyleoptiontoolbutton-members.html
/usr/share/doc/qt6/qtwidgets/qstyleoptiontoolbutton.html
/usr/share/doc/qt6/qtwidgets/qstyleoptionviewitem-members.html
/usr/share/doc/qt6/qtwidgets/qstyleoptionviewitem.html
/usr/share/doc/qt6/qtwidgets/qstylepainter-members.html
/usr/share/doc/qt6/qtwidgets/qstylepainter.html
/usr/share/doc/qt6/qtwidgets/qstyleplugin-members.html
/usr/share/doc/qt6/qtwidgets/qstyleplugin.html
/usr/share/doc/qt6/qtwidgets/qswipegesture-members.html
/usr/share/doc/qt6/qtwidgets/qswipegesture.html
/usr/share/doc/qt6/qtwidgets/qsystemtrayicon-members.html
/usr/share/doc/qt6/qtwidgets/qsystemtrayicon.html
/usr/share/doc/qt6/qtwidgets/qt-wrap-ui.html
/usr/share/doc/qt6/qtwidgets/qtabbar-members.html
/usr/share/doc/qt6/qtwidgets/qtabbar.html
/usr/share/doc/qt6/qtwidgets/qtableview-members.html
/usr/share/doc/qt6/qtwidgets/qtableview.html
/usr/share/doc/qt6/qtwidgets/qtablewidget-members.html
/usr/share/doc/qt6/qtwidgets/qtablewidget.html
/usr/share/doc/qt6/qtwidgets/qtablewidgetitem-members.html
/usr/share/doc/qt6/qtwidgets/qtablewidgetitem-obsolete.html
/usr/share/doc/qt6/qtwidgets/qtablewidgetitem.html
/usr/share/doc/qt6/qtwidgets/qtablewidgetselectionrange-members.html
/usr/share/doc/qt6/qtwidgets/qtablewidgetselectionrange.html
/usr/share/doc/qt6/qtwidgets/qtabwidget-members.html
/usr/share/doc/qt6/qtwidgets/qtabwidget.html
/usr/share/doc/qt6/qtwidgets/qtapandholdgesture-members.html
/usr/share/doc/qt6/qtwidgets/qtapandholdgesture.html
/usr/share/doc/qt6/qtwidgets/qtapgesture-members.html
/usr/share/doc/qt6/qtwidgets/qtapgesture.html
/usr/share/doc/qt6/qtwidgets/qtextbrowser-members.html
/usr/share/doc/qt6/qtwidgets/qtextbrowser.html
/usr/share/doc/qt6/qtwidgets/qtextedit-extraselection-members.html
/usr/share/doc/qt6/qtwidgets/qtextedit-extraselection.html
/usr/share/doc/qt6/qtwidgets/qtextedit-members.html
/usr/share/doc/qt6/qtwidgets/qtextedit.html
/usr/share/doc/qt6/qtwidgets/qtilerules-members.html
/usr/share/doc/qt6/qtwidgets/qtilerules.html
/usr/share/doc/qt6/qtwidgets/qtimeedit-members.html
/usr/share/doc/qt6/qtwidgets/qtimeedit.html
/usr/share/doc/qt6/qtwidgets/qtoolbar-members.html
/usr/share/doc/qt6/qtwidgets/qtoolbar.html
/usr/share/doc/qt6/qtwidgets/qtoolbox-members.html
/usr/share/doc/qt6/qtwidgets/qtoolbox.html
/usr/share/doc/qt6/qtwidgets/qtoolbutton-members.html
/usr/share/doc/qt6/qtwidgets/qtoolbutton.html
/usr/share/doc/qt6/qtwidgets/qtooltip-members.html
/usr/share/doc/qt6/qtwidgets/qtooltip.html
/usr/share/doc/qt6/qtwidgets/qtreeview-members.html
/usr/share/doc/qt6/qtwidgets/qtreeview.html
/usr/share/doc/qt6/qtwidgets/qtreewidget-members.html
/usr/share/doc/qt6/qtwidgets/qtreewidget.html
/usr/share/doc/qt6/qtwidgets/qtreewidgetitem-members.html
/usr/share/doc/qt6/qtwidgets/qtreewidgetitem-obsolete.html
/usr/share/doc/qt6/qtwidgets/qtreewidgetitem.html
/usr/share/doc/qt6/qtwidgets/qtreewidgetitemiterator-members.html
/usr/share/doc/qt6/qtwidgets/qtreewidgetitemiterator.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-animation-easing-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-desktop-screenshot-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-desktop-systray-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-dialogs-licensewizard-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-dialogs-standarddialogs-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-dialogs-tabdialog-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-dialogs-trivialwizard-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-draganddrop-draggableicons-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-draganddrop-draggabletext-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-draganddrop-dropsite-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-effects-blurpicker-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-gallery-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-gestures-imagegestures-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-graphicsview-chip-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-graphicsview-collidingmice-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-graphicsview-diagramscene-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-graphicsview-dragdroprobot-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-graphicsview-elasticnodes-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-graphicsview-simpleanchorlayout-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-index.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-itemviews-addressbook-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-itemviews-basicsortfiltermodel-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-itemviews-coloreditorfactory-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-itemviews-combowidgetmapper-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-itemviews-editabletreemodel-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-itemviews-fetchmore-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-itemviews-frozencolumn-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-itemviews-simpletreemodel-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-itemviews-spinboxdelegate-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-itemviews-spreadsheet-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-itemviews-stardelegate-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-layouts-basiclayouts-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-layouts-flowlayout-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-mainwindows-menus-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-module.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-painting-affine-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-painting-basicdrawing-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-painting-composition-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-painting-deform-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-painting-gradients-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-painting-imagecomposition-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-painting-painterpaths-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-painting-pathstroke-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-painting-transformations-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-richtext-orderform-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-richtext-syntaxhighlighter-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-tools-completer-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-tools-customcompleter-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-tools-echoplugin-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-tools-regularexpression-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-tools-settingseditor-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-tools-styleplugin-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-tools-treemodelcompleter-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-tools-undoframework-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-touch-knobs-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-tutorials-notepad-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-tutorials-widgets-childwidget-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-tutorials-widgets-nestedlayouts-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-tutorials-widgets-toplevel-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-tutorials-widgets-windowlayout-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-widgets-analogclock-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-widgets-calculator-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-widgets-calendarwidget-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-widgets-groupbox-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-widgets-lineedits-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-widgets-scribble-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-widgets-shapedclock-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-widgets-shortcuteditor-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-widgets-sliders-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-widgets-spinboxes-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-widgets-tablet-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets-widgets-windowflags-example.html
/usr/share/doc/qt6/qtwidgets/qtwidgets.index
/usr/share/doc/qt6/qtwidgets/qtwidgets.qhp
/usr/share/doc/qt6/qtwidgets/qtwidgets.qhp.sha1
/usr/share/doc/qt6/qtwidgets/qundoview-members.html
/usr/share/doc/qt6/qtwidgets/qundoview.html
/usr/share/doc/qt6/qtwidgets/qvboxlayout-members.html
/usr/share/doc/qt6/qtwidgets/qvboxlayout.html
/usr/share/doc/qt6/qtwidgets/qwhatsthis-members.html
/usr/share/doc/qt6/qtwidgets/qwhatsthis.html
/usr/share/doc/qt6/qtwidgets/qwidget-members.html
/usr/share/doc/qt6/qtwidgets/qwidget-obsolete.html
/usr/share/doc/qt6/qtwidgets/qwidget-styling.html
/usr/share/doc/qt6/qtwidgets/qwidget.html
/usr/share/doc/qt6/qtwidgets/qwidgetaction-members.html
/usr/share/doc/qt6/qtwidgets/qwidgetaction.html
/usr/share/doc/qt6/qtwidgets/qwidgetitem-members.html
/usr/share/doc/qt6/qtwidgets/qwidgetitem.html
/usr/share/doc/qt6/qtwidgets/qwizard-members.html
/usr/share/doc/qt6/qtwidgets/qwizard.html
/usr/share/doc/qt6/qtwidgets/qwizardpage-members.html
/usr/share/doc/qt6/qtwidgets/qwizardpage.html
/usr/share/doc/qt6/qtwidgets/standard-dialogs.html
/usr/share/doc/qt6/qtwidgets/style
/usr/share/doc/qt6/qtwidgets/style-reference.html
/usr/share/doc/qt6/qtwidgets/style/offline-dark.css
/usr/share/doc/qt6/qtwidgets/style/offline-simple.css
/usr/share/doc/qt6/qtwidgets/style/offline.css
/usr/share/doc/qt6/qtwidgets/stylesheet-customizing.html
/usr/share/doc/qt6/qtwidgets/stylesheet-designer.html
/usr/share/doc/qt6/qtwidgets/stylesheet-examples.html
/usr/share/doc/qt6/qtwidgets/stylesheet-reference.html
/usr/share/doc/qt6/qtwidgets/stylesheet-syntax.html
/usr/share/doc/qt6/qtwidgets/stylesheet.html
/usr/share/doc/qt6/qtwidgets/widget-classes.html
/usr/share/doc/qt6/qtwidgets/widgets-changes-qt6.html
/usr/share/doc/qt6/qtwidgets/widgets-tutorial.html
/usr/share/doc/qt6/qtxml/examples-manifest.xml
/usr/share/doc/qt6/qtxml/images
/usr/share/doc/qt6/qtxml/images/arrow_bc.png
/usr/share/doc/qt6/qtxml/images/bgrContent.png
/usr/share/doc/qt6/qtxml/images/btn_next.png
/usr/share/doc/qt6/qtxml/images/btn_prev.png
/usr/share/doc/qt6/qtxml/images/bullet_dn.png
/usr/share/doc/qt6/qtxml/images/bullet_sq.png
/usr/share/doc/qt6/qtxml/images/home.png
/usr/share/doc/qt6/qtxml/images/ico_note.png
/usr/share/doc/qt6/qtxml/images/ico_note_attention.png
/usr/share/doc/qt6/qtxml/images/ico_out.png
/usr/share/doc/qt6/qtxml/images/logo.png
/usr/share/doc/qt6/qtxml/images/screenshot.png
/usr/share/doc/qt6/qtxml/qdomattr-members.html
/usr/share/doc/qt6/qtxml/qdomattr.html
/usr/share/doc/qt6/qtxml/qdomcdatasection-members.html
/usr/share/doc/qt6/qtxml/qdomcdatasection.html
/usr/share/doc/qt6/qtxml/qdomcharacterdata-members.html
/usr/share/doc/qt6/qtxml/qdomcharacterdata.html
/usr/share/doc/qt6/qtxml/qdomcomment-members.html
/usr/share/doc/qt6/qtxml/qdomcomment.html
/usr/share/doc/qt6/qtxml/qdomdocument-members.html
/usr/share/doc/qt6/qtxml/qdomdocument-obsolete.html
/usr/share/doc/qt6/qtxml/qdomdocument-parseresult-members.html
/usr/share/doc/qt6/qtxml/qdomdocument-parseresult.html
/usr/share/doc/qt6/qtxml/qdomdocument.html
/usr/share/doc/qt6/qtxml/qdomdocumentfragment-members.html
/usr/share/doc/qt6/qtxml/qdomdocumentfragment.html
/usr/share/doc/qt6/qtxml/qdomdocumenttype-members.html
/usr/share/doc/qt6/qtxml/qdomdocumenttype.html
/usr/share/doc/qt6/qtxml/qdomelement-members.html
/usr/share/doc/qt6/qtxml/qdomelement.html
/usr/share/doc/qt6/qtxml/qdomentity-members.html
/usr/share/doc/qt6/qtxml/qdomentity.html
/usr/share/doc/qt6/qtxml/qdomentityreference-members.html
/usr/share/doc/qt6/qtxml/qdomentityreference.html
/usr/share/doc/qt6/qtxml/qdomimplementation-members.html
/usr/share/doc/qt6/qtxml/qdomimplementation.html
/usr/share/doc/qt6/qtxml/qdomnamednodemap-members.html
/usr/share/doc/qt6/qtxml/qdomnamednodemap.html
/usr/share/doc/qt6/qtxml/qdomnode-members.html
/usr/share/doc/qt6/qtxml/qdomnode.html
/usr/share/doc/qt6/qtxml/qdomnodelist-members.html
/usr/share/doc/qt6/qtxml/qdomnodelist.html
/usr/share/doc/qt6/qtxml/qdomnotation-members.html
/usr/share/doc/qt6/qtxml/qdomnotation.html
/usr/share/doc/qt6/qtxml/qdomprocessinginstruction-members.html
/usr/share/doc/qt6/qtxml/qdomprocessinginstruction.html
/usr/share/doc/qt6/qtxml/qdomtext-members.html
/usr/share/doc/qt6/qtxml/qdomtext.html
/usr/share/doc/qt6/qtxml/qtxml-dombookmarks-example.html
/usr/share/doc/qt6/qtxml/qtxml-index.html
/usr/share/doc/qt6/qtxml/qtxml-module.html
/usr/share/doc/qt6/qtxml/qtxml.index
/usr/share/doc/qt6/qtxml/qtxml.qhp
/usr/share/doc/qt6/qtxml/qtxml.qhp.sha1
/usr/share/doc/qt6/qtxml/style
/usr/share/doc/qt6/qtxml/style/offline-dark.css
/usr/share/doc/qt6/qtxml/style/offline-simple.css
/usr/share/doc/qt6/qtxml/style/offline.css
/usr/share/doc/qt6/qtxml/xml-changes-qt6.html
/usr/share/doc/qt6/qtxml/xml-dom-tml.html
/usr/share/doc/qt6/qtxml/xml-namespaces.html
/usr/share/doc/qt6/qtxml/xml-processing.html
/usr/share/doc/qt6/qtxml/xml-streaming.html
/usr/share/doc/qt6/qtxml/xml-tools.html


Generated by rpm2html 1.8.1

Fabrice Bellet, Wed Oct 29 04:48:15 2025